Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16380-AT4G34580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sec14p-like phosphatidylinositol transfer family protein
Function (paralog2):Sec14p-like phosphatidylinositol transfer family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.75610731424258
Log2 mRNA fold difference:-1.0970547386119
Log2 TE fold difference:0.33926086084537
Sequences
Protein sequence

MADTKQDMENSEDGRKLVKMSSLKQKAISASNRFKNSFKKKTRRTSSKIVSVANTDDING
DDYLSVEAFRQVLVLDDLLPPKHDDLHMMLRFLRARKFDKEKAKQMWSDMLQWRMDFGVD
TIIEDFEFEEIDQVLKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQATTMDRYEKYHVK
EFEKMFKIKFPSCSAAAKKHIDQSTTIFDVQGVGLKNFNKSARELLQRLLKIDNDNYPET
LNRMFIINAGPGFRLLWAPIKKFLDPKTTSKIHVLGNKYQPKLLEAIDASELPYFFGGLC
TCADKGGCLRSDKGPWNDPELLKIARNPEARFSTISEEDYLLVEEGTSMSMVFEPLERNK
MKTIEENVSEKHIDAVDKFMALSLPPKPHLKTLRKGKEPQKKDDSFLVGGVIAFVMGIVA
MLRLSKAVPRKLTDVALLTNSVYYEEAKMSKPNQDEVSAPPVSSSEYVIMVKRMAELEEK
YKSLDSKSADEALEKDDKLQAALNRVQVLEHELSETKKALDETMVNQQGILAYIEKKNKK
KRMFFRF

MAETKPEIEMSEEERKIVKISSLKKKAINASNRFKNSFKKKGRRSSSRVMSVPIEDDIDA
EDLQALDAFRQALILDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGAD
TIIEDFDFEEIDEVMKHYPQGYHGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVK
EFEKTFKVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPET
LNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGAC
TCEDKGGCMRSDKGPWNDPEVLKIAINREAKCSPISEDEHKHVDQGRSTSGFESLERIKK
KTDEDNVYEKQIATIDKSMDMAWLAKTQKAENFPISKGLECYVRKGAPKKGDGLLVGGVM
AFVMGIVAMVRLSKDVPRKLTEAALYGNSVCYEESTKSKQNQGQFAAPVSSSEYMLMVKR
MAELEDKCMFLDLKPAHVESEKEEKLQAALNRVQVLEQELTETKKALEEALVSQKEILAY
IEKKKKKKKLFFGF

www.000webhost.com

Other information
Ka divergence:-0.477562KaKs divergence:-0.832165
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1644Length 2 (bp):1665Length divergence:0.006
MFE 1 (kcal):-472.88MFE 2 (kcal):-495.11MFE divergence0.023