Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16400-AT4G34610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BEL1-like homeodomain 7
Function (paralog2):BEL1-like homeodomain 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.32453689455552
Log2 mRNA fold difference:-0.19432536783799
Log2 TE fold difference:-0.12369246220942
Sequences
Protein sequence

MATYYKTGSSEIYSRPEFVPGNAMNYTNSFTETFPRDSTNNVSPSKEIQVLSSLGGVSQM
VEIQDSGSWRDQEDNDRNRFPVMRRLGLSSQIETSRGNNNNEYATQVVSGFTRTIHNSKY
LKAAQELLDETVNVKKALKQFQPEGDKINEVKEKNLQTNTAEIPQAERQELQSKLSKLLS
ILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILV
IRKSLGGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVL
RAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRLWKPMVEEMYKEEFTDAL
QENDPNQSSENTPEITEIQELQTESSSNNGHVPGVASSSMRQNTVAHGGDRFMMVTDMTR
NGNGGMSLTLGIQNSDARGDVPMSGGIDNYKNTISGTDLQYLNSRNHQHQIGSSQLLHDF
VA

MENYPETQFIPGDSMIQNAIVSYSEESAGRERRTEANNVSASQERQALSRFGGVPQMQNI
GQDFGSWRDQASDRNGFQLMSAMAGATGILQTGQGLSLSLGSQILPGIHQISHQNMAPRG
NEYATQSFPGGNQNLDVVRTIPNSKYLKAAQQLLDEAVNVKKALKQFQAEGDKNNENPQE
PNQSTQDSSTNPPADISQSERQEMQSKLTKLLSMLDEVDRRYKQYYQQMQIVVSSFDVIA
GYGAAKPYTALALQTISRHFRSLRDAISGQILVLRKCLGEQQDGSDGKRVGIISRLKYVD
QHLRQQRGFMQPQAWRPQRGLPENSVLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQ
VSNWFINARVRLWKPMVEEIYKEEFTENDSNSSSENTPKMSEIGPVAADDEDRAREFSQD
QTKPDHGHGYGEETRGMVQGSHMDGRRFMAVEPTYHVADTSRLGRGDVSLTLGLQNSQGQ
DNVVAMSSEAYNNFSGVDIYENAIPGDEMEYVNPGSRQNRINSSQLVHDFVA

www.000webhost.com

Other information
Ka divergence:-0.102274KaKs divergence:-0.103968
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1449Length 2 (bp):1599Length divergence:0.049
MFE 1 (kcal):-443.2MFE 2 (kcal):-531.2MFE divergence0.09