Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16500-AT4G34710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arginine decarboxylase 1
Function (paralog2):arginine decarboxylase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.4511710627444
Log2 mRNA fold difference:1.181903365741
Log2 TE fold difference:0.93632457236883
Sequences
Protein sequence

MPALAFVDTPIDTFSSIFTPSSVSTAVVDGSCHWSPSLSSSLYRIDGWGAPYFAANSSGN
ISVRPHGSNTLPHQDIDLMKVVKKVTDPSGLGLQLPLIVRFPDVLKNRLECLQSAFDYAI
QSQGYDSHYQGVYPVKCNQDRFIIEDIVEFGSGFRFGLEAGSKPEILLAMSCLCKGNPEA
FLVCNGFKDSEYISLALFGRKLELNTVIVLEQEEELDLVIDLSQKMNVRPVIGLRAKLRT
KHSGHFGSTSGEKGKFGLTTVQILRVVRKLSQVGMLDCLQLLHFHIGSQIPSTALLSDGV
AEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAAAVVASVRFV
CDQKSVKHPVICSESGRAIVSHHSVLIFEAVSAGQQHETPTDHQFMLEGYSEEVRGDYEN
LYGAAMRGDRESCLLYVDQLKQRCVEGFKEGSLGIEQLAGVDGLCEWVIKAIGASDPVLT
YHVNLSVFTSIPDFWGIDQLFPIVPIHKLDQRPAARGILSDLTCDSDGKINKFIGGESSL
PLHEMDNNGCSGGRYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHGFAVTRAVM
GQSSADVLRAMQHEPELMFQTLKHRAEEPRNNNNKACGDKGNDKLVVASCLAKSFNNMPY
LSMETSTNALTAAVNNLGVYYCDEAAAGGGGKGKDENWSYFG

MPALACVDTSFVPPAYAFSDTAGDVFIPASSPTSAAVVVDRWSPSLSSSLYRIDGWGAPY
FIANSSGNISVRPHGSETLPHQDIDLLKIVKKVTGPKSSGGLGLQLPLIVRFPDVLKNRL
ECLQSAFDYAIKSQGYDSHYQGVYPVKCNQDRFVVEDIVKFGSSFRFGLEAGSKPEILLA
MSCLCKGSPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVR
PVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLRQSGMLDCLQLLHFHIGSQ
IPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEY
AEAVVASVRVVCDRSSVKHPVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPGDIQFL
LEGNEEARANYEDLYAAVMRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEW
VLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSD
GKINKFIGGESSLPLHELDKNGSGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSD
GPHSFAVTRAVPGQSSADVLRAMQHEPELMFQTLKHRAEEMMHTKGGSEGENEEEEEDDE
FNNVAASLDRSFHNMPYLATEQASPSNSLSAAISNLGFYYCDEDVYDYISA

www.000webhost.com

Other information
Ka divergence:-0.149431KaKs divergence:-0.266281
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):2109Length 2 (bp):2136Length divergence:0.006
MFE 1 (kcal):-702.2MFE 2 (kcal):-727.52MFE divergence0.018