Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16510-AT4G34720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATPase, F0/V0 complex, subunit C protein
Function (paralog2):ATPase, F0/V0 complex, subunit C protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.8063566454905
Log2 mRNA fold difference:0.75775351368191
Log2 TE fold difference:0.045508394486079
Sequences
Protein sequence

MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
RANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE

MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
RANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):495Length 2 (bp):495Length divergence:0
MFE 1 (kcal):-154.17MFE 2 (kcal):-170.66MFE divergence0.051