Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16570-AT4G34740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GLN phosphoribosyl pyrophosphate amidotransferase 1
Function (paralog2):GLN phosphoribosyl pyrophosphate amidotransferase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.5627245832422
Log2 mRNA fold difference:1.694165735961
Log2 TE fold difference:0.83917817838014
Sequences
Protein sequence

MAATTSFSSSLSLITKPNNSSYTNQPLPLFPKPFLKPPHLSLLPSPLSSPPPSLIHGVSS
YFSSPSPSEDNSHTPFDYHNDEDDEKPREECGVVGIYGDPEASRLCYLALHALQHRGQEG
AGIVTVSPEKVLQTITGVGLVSEVFNESKLDQLPGEFAIGHVRYSTAGASMLKNVQPFVA
GYRFGSIGVAHNGNLVNYKTLRAMLEENGSIFNTSSDTEVVLHLIAISKARPFFMRIIDA
CEKLQGAYSMVFVTEDKLVAVRDPYGFRPLVMGRRSNGAVVFASETCALDLIEATYEREV
YPGEVLVVDKDGVKSQCLMPKFEPKQCIFEHIYFSLPNSIVFGRSVYESRHVFGEILATE
SPVECDVVIAVPDSGVVAALGYAAKSGVPFQQGLIRSHYVGRTFIEPSQKIRDFGVKLKL
SPVRGVLEGKRVVVVDDSIVRGTTSSKIVRLLREAGAKEVHMRIASPPIVASCYYGVDTP
SSEELISNRLSVEEINEFIGSDSLAFLSFDTLKKHLGKDSKSFCYACFTGDYPVKPTEVK
VKRGGGDFIDDGLVGSFENIEAGWVR

MAATSSISSSLSLNAKPNKLSNNNNNNKPHRFLRNPFLNPSSSSFSPLPASISSSSSSPS
FPLRVSNPLTLLAADNDDYDEKPREECGVVGIYGDSEASRLCYLALHALQHRGQEGAGIV
TVSKDKVLQTITGVGLVSEVFSESKLDQLPGDIAIGHVRYSTAGSSMLKNVQPFVAGYRF
GSVGVAHNGNLVNYTKLRADLEENGSIFNTSSDTEVVLHLIAISKARPFFMRIVDACEKL
QGAYSMVFVTEDKLVAVRDPHGFRPLVMGRRSNGAVVFASETCALDLIEATYEREVYPGE
VLVVDKDGVKCQCLMPHPEPKQCIFEHIYFSLPNSIVFGRSVYESRHVFGEILATESPVD
CDVVIAVPDSGVVAALGYAAKAGVAFQQGLIRSHYVGRTFIEPSQKIRDFGVKLKLSPVR
GVLEGKRVVVVDDSIVRGTTSSKIVRLLREAGAKEVHMRIASPPIIASCYYGVDTPSSNE
LISNRMSVDEIRDYIGCDSLAFLSFETLKKHLGEDSRSFCYACFTGDYPVKPTEDKVKRG
GDFIDDGLVGGIHNIEGGWVR

Other information
Ka divergence:-0.0799015KaKs divergence:0.291028
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1701Length 2 (bp):1686Length divergence:-0.004
MFE 1 (kcal):-539.62MFE 2 (kcal):-530.12MFE divergence-0.009