Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16580-AT4G34760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.8612262439608
Log2 mRNA fold difference:6.0318744992971
Log2 TE fold difference:-1.5222776459984
Sequences
Protein sequence

MSILKKSTKLAQTAMLRQILKRCSSLGKKNGGGGYEEVDLPLDVPKGHFPVYVGHNRSRY
IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR

MAIMKKTSKLTQTAMLKQILKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYI
VPISFLTHPEFQSLLQRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR

www.000webhost.com

Other information
Ka divergence:-0.476247KaKs divergence:-0.157085
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):327Length 2 (bp):324Length divergence:-0.005
MFE 1 (kcal):-85.1MFE 2 (kcal):-92MFE divergence0.039