Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16600-AT4G34870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):rotamase CYP 3
Function (paralog2):rotamase cyclophilin 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.15631814280104
Log2 mRNA fold difference:-0.076346189886362
Log2 TE fold difference:0.062428806213387
Sequences
Protein sequence

MATNPKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSS
FHRVIPKFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQF
FICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS

MSNPRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIF
HRVIPGFMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFF
ICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQLS

Other information
Ka divergence:0.222051KaKs divergence:-0.00510806
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):522Length 2 (bp):519Length divergence:-0.003
MFE 1 (kcal):-152.7MFE 2 (kcal):-172.42MFE divergence0.061