Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16660-AT4G34950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.72440351821631
Log2 mRNA fold difference:0.095602840174073
Log2 TE fold difference:0.42947163171576
Sequences
Protein sequence

MGFQRSISSSSALKWLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLNQLELNNLSVAKD
VGKAFGILAGLASDRLPTPVILLIGCFEGLLGYGVQWLVVSRTIQPIPYWQMCIFLCMGG
NSTTWMNTAVLVTCIRNFRRNRGPVSGILKGYVGLSTAIFTDLCTALFSNDPASFLVLLA
VVPFAVCLTAVFFLREIPPASSAAEENEETRYFTIFNIVAVVVAVYLQSYDIIGIKTGVF
SVAFASILLFLLASPIAIPFHSFIKSLNYGEQDDLEGRIQEPLLRSEIAAAEKEVIVVAA
VAAEEEEKKRKKPVLGEDHTIMEAVLTVDFWVLFVSFLCGVGTGLAVMNNMGQIGLALGY
TNVSIFVSMTSIWGFFGRILSGTLSEYFLKKAGTPRPLWNAASQILMAVGYILMALAVPN
SLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNILVLNLPLGSFLFSGLLAGFLY
DAEATPTPGGGNTCVGAHCYRLIFIVMALASVIGVGLDLVLAYRTKEIYAKIHASKKSKK
SGGSLS

MGFGTSSSSSSSSALKWLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLTQLELNSLSVA
KDVGKAFGILAGLASDRLSTPVILLIGSFEGLLGYGVQWLVVSRTIQPIPYWQMCVFLCM
GGNSTTWMNTAVLVTCIRNFRRNRGPVSGILKGYVGLSTAIFTDLCNALFSSDPASFLVL
LSVVPFAVCLTAVFFLREIPPSTTFAEDNEESKYFAVFNIVAVVVAVYLQSYDIIGIKTG
AFSIAFASILLILLASPVAVPFHAFIRSKVHDEQDVEGRIDEPLLRSGSEIEVEETIVGA
AAAADNELPPSLKPLSNEEEENHGTIVTTEKKRPVLGEEHTIMEAMLTVDFWVLFVSFLC
GVGTGLAVMNNMGQIGLALGYTDVSIFVSMTSIWGFFGRILSGTISEHFIKKAGTPRPLW
NAAAQIIMAVGYLLMALALPGSLYIGSMVVGVCYGVRLAITVPTASELFGLKYYGLIYNI
LILNMPLGSFLFSGLLAGLLYDAEATPTPGGGNTCVGAHCFRIVFIVMAFASIIGVGLDL
LLAYRTKGIYAKIHASKKTKKSGGNLR

Other information
Ka divergence:0.121174KaKs divergence:-0.267654
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1641Length 2 (bp):1704Length divergence:0.019
MFE 1 (kcal):-510.75MFE 2 (kcal):-515.26MFE divergence0.004