Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16700-AT4G34970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin depolymerizing factor 5
Function (paralog2):actin depolymerizing factor 9

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.2093355734338
Log2 mRNA fold difference:-1.487770604069
Log2 TE fold difference:0.34947793140588
Sequences
Protein sequence

MAMAFKMATTGMRVTDECTSSFMDMKWKKVHRYIVFKIEEKSRKVTVDKVGGAGESYHDL
EDSLPVDDCRYAVFDFDFVTVDNCRKSKIFFIAWSPEASKIRAKILYATSKDGLRRVLEG
IHYELQATDPTEMGFDIIQDRAK

MALKTATSGMWMTDDCKKSFMEMKWKKVHRYVVYKLEEKSRKVTVDKVGAAGESYDDLAA
SLPEDDCRYAVFDFDYVTVDNCRMSKIFFITWSPEASRIREKMMYATSKSGLRRVLDGVH
YELQATDPTEMGFDKIQDRAK

www.000webhost.com

Other information
Ka divergence:0.324174KaKs divergence:0.999902
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):432Length 2 (bp):426Length divergence:-0.007
MFE 1 (kcal):-127.8MFE 2 (kcal):-145.4MFE divergence0.064