Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16720-AT4G34990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 7
Function (paralog2):myb domain protein 32

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7103248131353
Log2 mRNA fold difference:-2.0686084545731
Log2 TE fold difference:0.3495042827705
Sequences
Protein sequence

MGRSPCCEKEHMNKGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINY
LRPDLKRGNFTHDEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSKG
IDPATHRGINEAKISDLKKTKDQIVKDVSFVTKFEETDKSGDQKQNKYIRNGLVCKEERV
VVEEKIGPDLNLELRISPPWQNQREISTCTASRFYMENDMECSSETVKCQTENSSSISYS
SIDISSSNVGYDFLGLKTRILDFRSLEMK

MGRSPCCEKDHTNKGAWTKEEDDKLISYIKAHGEGCWRSLPRSAGLQRCGKSCRLRWINY
LRPDLKRGNFTLEEDDLIIKLHSLLGNKWSLIATRLPGRTDNEIKNYWNTHVKRKLLRKG
IDPATHRPINETKTSQDSSDSSKTEDPLVKILSFGPQLEKIANFGDERIQKRVEYSVVEE
RCLDLNLELRISPPWQDKLHDERNLRFGRVKYRCSACRFGFGNGKECSCNNVKCQTEDSS
SSSYSSTDISSSIGYDFLGLNNTRVLDFSTLEMK

www.000webhost.com

Other information
Ka divergence:-0.138913KaKs divergence:-0.827849
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):810Length 2 (bp):825Length divergence:0.009
MFE 1 (kcal):-226.2MFE 2 (kcal):-238.89MFE divergence0.027