Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16750-AT4G35030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase protein with adenine nucleotide alpha hydrolases-like domain
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3682355513555
Log2 mRNA fold difference:-0.52489125275709
Log2 TE fold difference:-0.84130197299093
Sequences
Protein sequence

MAVDKVIVKQRNIILVGIPIDESGVEVLKWALEEVAKHGDCVVVVHVCFTYYRALKSKSS
LDRYLKPYIEFCSTKKIELKGEVLKGNSVLGVLVKEAKRYNAMSVVVGVKQQSKLSLKIA
KGCAKELPSTTDILAIHRGNIVFRRSNHYQLPLAQKISSRPSSELSEGFSDKDLAKTTGQ
EKRKISGRSLSLPSVEVVDQTPGWPLLRTSTLATPMVQHQTRKISVVNWVMSLPERFPHH
PNQTCQQSFCDKQLKDILKDINRWFSYDVLKTATSDFSLENLIGKGGCNEVYKGFLEDGK
GVAVKILKPSVKEAVKEFVHEVSIVSSLSHSNISPLIGVCVHYNDLISVYNLSSKGSLEE
TLQGKHVLRWEERLKIAIGLGEALDYLHNQCSNPVIHRDVKSSNVLLSDEFEPQLSDFGL
SMWGSKSCRYTIQRDVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTSISSDS
PRGQESLVMWAKPMIEKGNAKELLDPNIAGTFDEDQFHKMVLAATHCLTRAATYRPNIKE
ILKLLRGEDDVSKWVKIEEDDEDGFDDEVYPNSNTELHLSLAMVDVEDNDSVSNSSLERS
NNSLFSSSSSSSQELQS

MGEEKRRISGRSVSLPSIDILLDEKPGWPFLKRASLGTPQQVHKWHTRKVSVVNWVMSLP
ERFPNHQQTLNYETSLIKKQIKDILRDNNKWFNYNVLRKATSDFSQENVIGKGGCNEVYR
GILEDGKGIAVKILKSSSKEAMTNFVHEINIISSLSHQNISPLLGVCVQDNELISVYNLS
NTGSLEETLHGKQKGKYVLSWEERFKIAIGLAEALDYLHNRCSKPVIHRDVKTSNVLLSL
ELQPQLSDFGLSMWGPTTSSRYSIQGDVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLE
LISGRNPISPQNPRGQESLVMWAKPLIDTGNLKVLLDPDVTDIFDESQFQRMVLAASHCL
TRSATHRPNIRQILRLLRDENEAGKWIMEEEGNEDCFDDEVYPNSSTELHLNLAMLEVED
DETASISSMERSNNSLFSSTCSSRELQT

www.000webhost.com

Other information
Ka divergence:-0.051011KaKs divergence:0.232474
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):1854Length 2 (bp):1347Length divergence:-0.158
MFE 1 (kcal):-553.1MFE 2 (kcal):-352.67MFE divergence-0.221