Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16770-AT4G35040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Basic-leucine zipper (bZIP) transcription factor family protein
Function (paralog2):Basic-leucine zipper (bZIP) transcription factor family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.5212648040497
Log2 mRNA fold difference:1.3089371993895
Log2 TE fold difference:0.22100337203182
Sequences
Protein sequence

MDDGELEFSNSNMGGELPSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHT
KILPDKVSTDDTSESSGKKRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRL
QGQAALEAEVTRLKCLLVDIRGRIDGEIGAFPYQKPAVTNVPYSYMMHPCNMQCDVDNLY
CLQNGNNGEGASMNEQGLNGCEFDQLECLANQNLAGKEIPVCSNGIGTFTVNGSGVNKRK
GEPRAAKAV

MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT
HTCFHVHTKILPDESDEKVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDE
VARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRIDGEIGSFPYQKPMAANIPSFS
HMMNPCNVQCDDEVYCPQNVFGVNSQEGASINDQGLSGCDFDQLQCMANQNLNGNGNGSF
SNVNTSVSNKRKGGHRASRAV

www.000webhost.com

Other information
Ka divergence:0.0722487KaKs divergence:0.114395
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):750Length 2 (bp):786Length divergence:0.023
MFE 1 (kcal):-215.7MFE 2 (kcal):-229.03MFE divergence0.03