Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16780-AT4G35050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin family protein / WD-40 repeat family protein
Function (paralog2):Transducin family protein / WD-40 repeat family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.0722029528899
Log2 mRNA fold difference:-0.66923606445813
Log2 TE fold difference:-0.33222418918742
Sequences
Protein sequence

MADEGKEETGMGQVEEDFSVWKKNTPFLYDLLISHPLEWPSLTVHWVPSTPNPYVADSYF
GVHKLILGTHTSGSAQDFLMVADVVTPTPNAEPGIGGANQDPFIPKVEIRQRIRVDGEVN
RARCMPQKPTLVGAKTSGCEVFLFDYAKHAAKSQTSECDPDLRLVGHDKEGYGLSWSPFK
EGYLLSGSQDQKICLWDVSATPQDKVLNAMFVYEGHESAIADVSWHMKNENLFGSAGEDG
RLVIWDTRTNQMQHQVKVHEREVNYLSFNPFNEWVLATASSDSTVALFDLRKLNAPLHVM
SSHEGEVFQVEWDPNHETVLASSGEDRRLMVWDLNRVGEEQLEIELDAEDGPPELLFSHG
GHKAKISDFAWNKNEPWVIASVAEDNSLQVWQMAESIYRDEEDAEDIKEDITQQS

MAAEEGKDEAGLDQVEEEFSIWKRNTPFLYDLMISHPLEWPSLTLHWVPSTPIPYSKDPY
FAVHKLILGTHTSGGAQDFLMVADVVIPTPDAEPGLGGRDQEPIVPKVEIKQKIRVDGEV
NRARCMPQKPTLVGAKTSGSEVFLFDYARLSGKPQTSECDPDLRLMGHEQEGYGLAWSSF
KEGYLLSGSQDQRICLWDVSATATDKVLNPMHVYEGHQSIIEDVAWHMKNENIFGSAGDD
CQLVIWDLRTNQMQHQVKVHEREINYLSFNPFNEWVLATASSDSTVALFDLRKLTAPLHV
LSKHEGEVFQVEWDPNHETVLASSGEDRRLMVWDINRVGDEQLEIELDAEDGPPELLFSH
GGHKAKISDFAWNKDEPWVISSVAEDNSLQVWQMAESIYREDDEDEDDDDEGNQNAQHSN
ENQK

www.000webhost.com

Other information
Ka divergence:0.0503337KaKs divergence:0.252943
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1248Length 2 (bp):1275Length divergence:0.011
MFE 1 (kcal):-407.48MFE 2 (kcal):-414.35MFE divergence0.008