Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16800-AT4G35080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):high-affinity nickel-transport family protein
Function (paralog2):high-affinity nickel-transport family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0882121049604
Log2 mRNA fold difference:-1.8758766188145
Log2 TE fold difference:0.72788719441258
Sequences
Protein sequence

MDRLLQPPSSHSIAPSKFQSRPSPLLLHRLHSTNLSTFPSSRRLESRRISSISCFFRQNP
SPDTSPGLNQSSNFLIASSQTDASKPNPGFIQRIVSSFEQRKTISAGMVILVSAIAALLL
NPILVPPAFASFQTATNSGGAAVVGGKLLRTEVLTSAWTGFFAGCLHTLSGPDHLAALAP
LSIGRTRMESAAVGALWGCGHDAGQLIFGLLFLLLKDRLHIEVIRTWGTRVVGLTLLVIG
AMGIKEASEMPEPCVVTLENGETDEKSLKKKKIGFATFATGIVHGLQPDALMMVLPALAL
PSRIAGASFLIMFLIGTVIAMGSYTVFIGSCSEALKEKVPRITEKLTWASSLVAIGLGLA
IIVSQFFGFSLY

MERLLQPSSSSSSISPSKFPSRTSPFLPRLRSSGLSFVSTHRPESRRVSSISCNSSQIPS
LYTPIGSNTTNNSFNGSPKSDESKPNPGFLTRIATSASEQRKETYEKFVYSLLEKKIPRI
TKSSNFTLSTGTVILISAVAVLLLNPLLAPPAFASFQTAAKSGWLTSAWTGFLAGCLHTL
SGPDHLAALAPLSIGRSKMESAAVGALWGCGHDAGQVIFGLLFLLLKDRLHIEVLQTWGT
RIVGLTLVIIGAMGIKEASEIPEPCVALETDISMVSTEKEALPLPKKKKIGFATFATGVV
HGLQPDALMIVLPALALPSRLAGSAFLIMFLVGTVIAMGSYTAFIGSCSEALKEKVPRIT
EKLTWVSSLVAIGLGLGIVISPFFGFSLY

Other information
Ka divergence:0.031033KaKs divergence:0.0973648
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1119Length 2 (bp):1170Length divergence:0.022
MFE 1 (kcal):-345.7MFE 2 (kcal):-333.19MFE divergence-0.018