Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16850-AT4G35100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plasma membrane intrinsic protein 2;8
Function (paralog2):plasma membrane intrinsic protein 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.7446905072899
Log2 mRNA fold difference:5.1908902777234
Log2 TE fold difference:-0.51306462385422
Sequences
Protein sequence

MSKEVSEEGRHGKDYVDPPPAPLLDMAELKLWSFYRAIIAEFIATLLFLYVTVATVIGHK
NQTGPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAYM
VAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSAT
DPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHW
IFWVGPFVGALAAAAYHQYILRAAAIKALASFRSNPTN

MSKEVSEEGKTHHGKDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLYVTVATVIG
HKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALG
YMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFS
ATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDD
QWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNATN

www.000webhost.com

Other information
Ka divergence:0.310885KaKs divergence:0.519459
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):837Length 2 (bp):843Length divergence:0.004
MFE 1 (kcal):-281.3MFE 2 (kcal):-272.01MFE divergence-0.017