Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16900-AT4G35110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Arabidopsis phospholipase-like protein (PEARLI 4) family
Function (paralog2):Arabidopsis phospholipase-like protein (PEARLI 4) family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.04274845029404
Log2 mRNA fold difference:-0.97625059343412
Log2 TE fold difference:0.87719372717284
Sequences
Protein sequence

MDVNRKAHPDCRYSSNPFHECASDCLEKISQGRGNKNSKKQGSKILSLPGSFGKKKTESQ
PPSPLSTRNYQNGAANTPKVRQSRPSPVAMKKTPVPEANKSLHSLSSDGISIDLNGQNDS
FNHKQEKPSRTVPLSPNSMADRGKPLSPRPQGHEHSGKNDTASEISLFNVVSPPRSCAND
DDDDDDENNGYEEGVELDLISVMSDSCVSVGKYRVNSSVSTILQSIIDKHGDIAANCKLE
SASMRSRYLECLCSLMQELGSTPVGQLTELKVKEMVAVLKDLESVNIDVGWMRSVLEEFA
QYQENTDSEKERQEGLVRSKKQEMEIQEADLARIEKEVAEARLRVEEMKAELAELETERL
RMEEMGFKVEKYKGKTFLDELL

MESNFVGSCSIHQKAMDFNRKAHPDCVYADNPFHECASACLEKIAQGHVKKNTKKQSSRL
LSFSGSFGRKKKESNSQPPTPLSARPYQNGRGGFANGNSPKVHHSVAPPASVKKKIVSET
KNSFTSSSSGDPDDFFNHKPEKKPSQTIPLSSNNLVDQSKVVSPKPGIQEHNGKIGEGGE
TRLFSFLSLPRSPGKESNDDFSDDDDENNNEIGVELDLESVMSDTFVSVGKYRVRSGSST
ILSAVIEKHGDIAQNCKLESDSMRSRYLECLCSLMQELRSTPVGQLSKVKVKEMLAVLKD
LESVNIEVAWLRSVLEEFAQSQEDVENEKERHDGLVKAKREELEAQETDLVRMEKEVVEV
KRRIEETRAQMVEIEAERLRMEKMGFKMEKFKGKSFIDELL

www.000webhost.com

Other information
Ka divergence:0.0483033KaKs divergence:0.0269542
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1149Length 2 (bp):1206Length divergence:0.024
MFE 1 (kcal):-333.7MFE 2 (kcal):-365.51MFE divergence0.045