Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G16970-AT2G16980
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.490504484116
Log2 mRNA fold difference:1.4996028623993
Log2 TE fold difference:-0.011331302495468
Sequences
Protein sequence

MEEYRLGELRHLLTTVFLSGFSEFLVKPVMTDVTVAAVCSGLNETCSLAVYLTGVEQVTV
GLGTMVMMPVIGNLSDRYGIKTLLTLPMCLSILPPAILAYRRDTNFFYAFYITKILFDMA
KNVCGRKRISMFGVLAGVRSISGVCATFSARLLPIASIFQVAAISFFFGLVYMRVFLKER
LHDDDEDDCDEDDNTSGRNHHDGGDLTMLAEPILRDAPTKIHIVLNTKYSSLKDMVSLIK
NSTILVQTLVVTFFATFAQSGMQSAFLYFLKARFGFNKNDFAELILLVTIIGSISQLFIL
PKLVSAIGERRVLSTGLLMDSVNAACLSVSWSAWVPYATTVLVPVTMFVMPSVCGIASRQ
VGPGEQGKVQGCISGVKSFSGVVAPFIYSPLTALFLSEKAPFYFPGFSLLCVTFSLMIGF
FLSLLIRDVPSPSMNKAINNISREEA

MEVFRLGELRHLLVTVFLSGLAEYLIRPVMTDVTVAAVCSGLDDSCSLAVYLTGVQQVTV
GMGTMVMMPVIGNLSDRYGIKAMLTLPMCLSVLPPAILGYRRDTNFFYAFYVIKTLFDMV
CQGTIDCLANAYVAKNVHGTKRISMFGILAGVSSISGVCASLSARFLSIASTFQVAAISL
FIGLVYMRVFLKERLQDADDDDEADSGGCRSHQEVHNGGDLKMLTEPILRDAPTKTHVFN
SKYSSWKDMVSLINNSTILIQALVVTFFATFSESGRGSALMYFLKARFGFNKNDFAELFL
LVTIIGSISQLFILPTLSSTIGERKVLSTGLLMEFFNATCLSVAWSPWVPYAMTMLVPGA
MFVMPSVCGIASRQVGSSEQGKVQGCISGVRAFAQVVAPFVYSPLTALFLSENAPFYFPG
FSILCIAISLMIGFLQSLLIKDHPSLPLVNITINNPSKAEA

www.000webhost.com

Other information
Ka divergence:-0.0707585KaKs divergence:0.541293
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1341Length 2 (bp):1386Length divergence:0.017
MFE 1 (kcal):-394.96MFE 2 (kcal):-420.32MFE divergence0.031