Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17030-AT2G17036
Species:Arabidopsis
Duplication type:TD
Function (paralog1):F-box family protein with a domain of unknown function (DUF295)
Function (paralog2):F-box family protein with a domain of unknown function (DUF295)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.1259986811607
Log2 mRNA fold difference:-1.6900290503701
Log2 TE fold difference:-0.41400620527802
Sequences
Protein sequence

MVDWSTLPKDLLDLISKSLESSFDLIQFRSVCSSWRSAAEPKSPLPTHHLPILPDNGGSL
FPDSAVGFRLSQRSILLIKPHEPCIESDSFGWLIKVEEDLNVPRKVTLLDPLCDTRNSIP
ENFPRVLDMSKFKVRELGREFKLHYFNTVGDIVESLYLEKAVVKYLDCDGDYKFVLLTIH
VSGKLAVFRSWDRAWTVINDMPSPYDDVMLFDGRFFAVDNNGRTVVVDYSSLKLTLVASP
VFGGDKKFLIESCGEMLLVDMYLSLEAVEGDPGFVEEIFEHPAFYMNERTVKFKVYRFVE
REESWVDVYDLEDKMLFLGDDSTFSASASDILPLCDGSSVFFNGNVFNGEDLGAMQDRDL
GVFDFRSGKIELVQKLPEYAKLFWPPPPWITSHARAEDHIGETSSQS

MDWATLPKDLLDLISKCLESSFDLIQFRSVCSSWRSAAGPKRLLWAHNLPFFPSDDKPFL
SNVILRVAHQSILLIKPNEPQCEADLFGWIVKVWDNIYVSRKMTLLKPLSSSRNYFPQHL
PRIFDMSKFTVRELCREVKLYHPDYYCVPGHTALELELGKTVVKYLNDDKFVLLTILEYG
KLAVFRSWDREWTVINDYIPSRCQDLIMFDGRFFAIDYNGRTVVVDYSSFKLTLAANPLI
GGGDKKFLIESCGEMFLVDIEFCLNEKPEFTGGFYSYFNETTVSYKFKFFKLVEREKRWV
EVEDLGDKMFFLGDDSTFSASTADIIPRCVGTGSFVFFYTHEESLVVMDDRNLGVFDFRS
GKTELVNKLPEYAKLFWPPPPWITTSHEVSGFQSLNHPNRVVLKIILEKHHHNPNLEFKT
LEMTLQLE

www.000webhost.com

Other information
Ka divergence:0.482954KaKs divergence:0.406311
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1224Length 2 (bp):1287Length divergence:0.025
MFE 1 (kcal):-353.36MFE 2 (kcal):-393.34MFE divergence0.054