Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17110-AT4G35240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF630 and DUF632)
Function (paralog2):Protein of unknown function (DUF630 and DUF632)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.2751057904092
Log2 mRNA fold difference:1.549900232887
Log2 TE fold difference:-0.26094123148595
Sequences
Protein sequence

MGCSTSKLDDLPAVALCRDRCSFLEAAIHQRYALSEAHVSYTQSLKAISHSLHQFINHHH
RYNDSDSPKKAKPKMDSGSGHLDFDSDSDSDDDDDIDSLHSSPLHHHLEDDDSNPKSYLH
MNYMKNSYMPPSLVYEQRPSSPQRVHFGESSSSSTSEYNPYLNSNYGSKLPPPPPSPPRE
KVWDFLDPFDTYYTPYTPSRDTRELRDELGVPDLEEDDVVVKEVHGKQKFVAAVSVEEPL
GNSGASTSGGGGGGGKASLYQTRPSVSVEKEEMEHEVHIVEKKIVEDSGGDEVRKSKAAV
ARGGGGVRRGVPEVAKEIEAQFLRAAESGNEIAVMLEVGKHPYGRKNVSSKKLYEGTPSP
SVVSSAQSSTSKKAKAEASSSVTAPTYADIEAELALKSRNLSSTLHKLHLWEKKLYDEVK
AEEKMRVNHEKKLRKLKRMDERGAENQKVDSTRKLVRSLSTKIRIAIQVVDKISVTINKI
RDEELWLQLNELIQGLSKMWKSMLECHKSQCEAIKEARGLGPIRASKNFGGEHLEVTRTL
GYELINWIVGFSSWVSAQKGFVRELNSWLMKCLFYEPEETPDGIVPFSPGRIGAPMIFVI
CNQWEQALDRISEKEVIEAIRRFTTSVLHLWEQDRLATRERIIGHGDPRNMDREEQRIQK
EIQELEMKMVLVGPGEDNIVYQSDTSNESLQGSLQRIFEAMERFTEESLKAYVDLLHRAE
EEECDSRETDEED

MGCTSSKLDDLPAVALCRERCAFLEAAIHQRYALAESHVAYTHSLREIGHSLHLFINHHH
RFVASGGANVGDSPRLNLPPQRKGDLDDEATNSPKKQKLASSHHNHNHAHSGSGSDSGHL
EFDSDSDEDEEDDDDLDLDSLHHHSPPHHHLGNFPIPESAPMGGYMEQQPGYINPYPNPD
MMGHPYSGGGSYMHMNYMKNKSMPPSVVYEQRPTSPQRVYIGESSSSYPYPPQNSYFGYS
NPVPGPGPGYYGSSSASTTAAATKPPPPPPSPPRSNGWDFLNPFDTYYPPYTPSRDSREL
REEEGIPDLEDDDSHYEVVKEVYGKPKFAAGGGHQPNPAAVHMMREESPSPPLDKSGAST
SGGGDVGDASAYQSRPSVSVEKEGMEYEVHVVEKKVVEDEERRSNATATRGGGGGGGPRA
VPEVAKEIENQFVKAAESGSEIAKLLEVGKHPYGRKHAASKMLHGVTPSLPSTSGGTSSS
AAAAVVPPTYADIEEELASRSRNLSSTLHKLHLWEKKLYHEVKAEEKLRLAHEKKLRKLK
RLDQRGAEAIKVDKTRKLVRDMSTKIRIAIQVVDKISVTINKIRDEDLWPQLNALIQGLT
RMWKTMLECHQSQCQAIREAQGLGPIRASKKLGDEHLEATSLLGHELINWILGFSSWVSA
QKGYVKELNKWLMKCLLYEPEETPDGIVPFSPGRIGAPPIFVICNQWSQALDRISEKEVI
EAMRSFTTSVLQLWEQDRLDTMMTGHGDSEKKVRNMDREEQRIQREIQALEKKMILVAPG
DGNSLSISGNVVYQSDTSSDSLQGSLQRIFEAMERFTAESMRAYEDLLERTNEETAPREL
EEEEEEILGFARLRLGQKAPFRMMI

www.000webhost.com

Other information
Ka divergence:-0.269671KaKs divergence:-0.230011
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):2202Length 2 (bp):2598Length divergence:0.083
MFE 1 (kcal):-675.12MFE 2 (kcal):-804.36MFE divergence0.087