Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17130-AT4G35260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):isocitrate dehydrogenase subunit 2
Function (paralog2):isocitrate dehydrogenase 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.66478510858347
Log2 mRNA fold difference:0.55352804554732
Log2 TE fold difference:0.094874929400546
Sequences
Protein sequence

MSRQSFSLLKNLRSIASGSKIQTRSVTYMPRPGDGKPRPVTLIPGDGVGPLVTNAVQQVM
EAMHAPVYFEPFEVHGDMKSLPEGLLESIKKNKVCLKGGLKTPVGGGVSSLNVNLRKELD
LFASLVNCFNLPGLASRHENVDIVVIRENTEGEYAGLEHEVVPGVVESLKVITKFCSERI
AKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCQEVAKKYPSIAYNEIIVDNCCMQL
VARPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGAEYAVFEQGASAGNVGKDTT
EEQKNANPVALLLSSAMMLRHLQFPSFADRLETAVKRVIAEGNCRTEDLGGNSTTQEVVD
AVIANLD

MSRRSLTLLKNLARNANGSGIQTRSVTYMPRPGDGAPRAVTLIPGDGIGPLVTNAVEQVM
EAMHAPIFFEKYDVHGEMSRVPPEVMESIRKNKVCLKGGLKTPVGGGVSSLNVQLRKELD
LFASLVNCFNLPGLPTRHENVDIVVIRENTEGEYAGLEHEVVPGVVESLKVITKFCSERI
AKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVAKKYPSITYNEIIVDNCCMQL
VAKPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGADHAVFEQGASAGNVGKDKI
VLENKANPVALLLSSAMMLRHLQFPSFADRLETAVKKVIAEGKCRTKDLGGTSTTQEVVD
AVIAKLD

Other information
Ka divergence:-0.358352KaKs divergence:0.240018
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1104Length 2 (bp):1104Length divergence:0
MFE 1 (kcal):-362.2MFE 2 (kcal):-359.06MFE divergence-0.004