Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17150-AT4G35270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant regulator RWP-RK family protein
Function (paralog2):Plant regulator RWP-RK family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.1845312124131
Log2 mRNA fold difference:0.14081253484211
Log2 TE fold difference:-3.047083469009
Sequences
Protein sequence

MEDDGGSDGGEGNGGFSPNSSFGAFADTAMDLDFMDELLFDGCWLETTDSKSLKQTEQSP
SASTAMNDNSPFLCFGENPSQDNFSNEETERMFPQAEKFLLEEAEVGKSWWIAPSASEGP
SSSVKERLLQAISGLNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYR
HVSETYNFPADEGMKDFVGLPGRVFLQKFPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLA
LPVFERGSGTCLGVVEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYS
DFYCAALPEIKDFLATICRSYDFPLALSWAPCARQGKVGSRHSDENFSECVSTIDSACSV
PDEQSKSFWEACSEHHLLQGEGIVGKAFEATKLFFVPEVATFSKTNYPLAHHAKISGLHA
ALAVPLKSKSGLVEFVLEFFFPKACLDTEAQQEMLKSLCVTLQQDFRSSNLFIKDLELEV
VLPVRETMLFSENLLCGAETVESLTEIQMQESSWIAHMIKANEKGKDVSLSWEYQKEDPK
ELSSGRENSQLDPVPNNVPLEAEQLQQASTPGLRVDIGPSTESASTGGGNMLSSRRPGEK
KRAKTEKTIGLEVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIMRWPSRKIKKVGHSL
KKLQLVMDSVQGAQGSIQLDSFYTSFPELNSPNMSSNGPSLKSNEQPSHLNAQTDNGIMA
EENPRSPSSSCSKSSGSSNNNENTGNILVAEDADAVLKRAHSEAQLHNVNQEETKCLART
QSHKTFKEPLVLDNSSPLTGSSNTSLRARGAIKVKATFGEARIRFTLLPSWGFAELKQEI
ARRFNIDDISWFDLKYLDDDKEWVLLTCEADLVECIDIYRLTQTHTIKISLNEASQVKLS
GSFGNTGLS

MEGGRGGGDGNFLPNSNFGVFSDSAMDMDFMDELLFDGCWLETTDGKSLKQTMGQQVSDS
TTMNDNNNNSYLYGYQYAENLSQDHISNEETGRKFPPIPPGFLKIEDLSNQVPFDQSAVM
SSAQAEKFLLEESEGGRRYWIAPRTSQGPSSSVKERLVQAIEGLNEEVQDKDFLIQIWLP
IQQEGKNFLTTSEQPHFFNPKYSSLKRYRDVSVAYNFLADEDSKESVGLPGRVFLKKLPE
WTPDVRFFRSEEYPRIKEAEQCDVRGSLALPVFERGSGTCLGVVEIVTTTQKMNYRPELD
NICKALESVNLRSSRSLNPPSREFLQVYNEFYYAALPEVSEFLTLVCRVYDLPLALTWAP
CARQGKVGSRHSDENFSECVSTVDDACIVPDHQSRHFLEACSEHHLLQGEGIVGKAFNAT
KLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKNKFNSSVEFVLEFFFPKACLDTEA
QQDMLKSLSATLQQDFRSLNLFIDKELELEVVFPVREEVVFAENPLINAGTGEDMKPLPL
EEISQEDSSWISHMIKANEKGKGVSLSWEYQKEEPKEEFMLTSGWDNNQIGSGHNNFLSE
AEQFQKVTNSGLRIDMDPSFESASFGVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAG
SLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKVGHSLKKLQLVIDSVQGVQGSIQLD
SFYTSFPELSSPHMSGTGTSFKNPNAQTENGVSAQGTAAAPKSPPSSSCSHSSGSSTCCS
TGANQSTNTGTTSNTVTTLMAENASAILKRARSEVRLHTMNQDETKSLSRTLSHKTFSEH
PLFENPPRLPENSSRKLKAGGASKVKATFGEAKVRFTLLPTWGFRELQHEIARRFNIDNI
APFDLKYLDDDKEWVLLTCEADLEECIDIYRSSQSRTIKISVHEASQVKLGGSFGSIGLG
PSL

Other information
Ka divergence:-0.0704957KaKs divergence:0.0386108
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2730Length 2 (bp):2892Length divergence:0.029
MFE 1 (kcal):-848.88MFE 2 (kcal):-856.76MFE divergence0.005