Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17190-AT2G17200
Species:Arabidopsis
Duplication type:TD
Function (paralog1):ubiquitin family protein
Function (paralog2):ubiquitin family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.18759957752087
Log2 mRNA fold difference:0.1032142977576
Log2 TE fold difference:-0.28692660900099
Sequences
Protein sequence

MGGEADSRQPLTAEGVAVAVNVRCSNGTKFSVTTSLDSTVESFKELIAQNSDVPANQQRL
IYKGRILKDDQTLLSYGLQADHTVHMVRGFVPSSPSAPAANAGNQTTAPQAVGSNDSSNL
GGGESLFPGLGFNPLGGGNAMAGLFGSGLPDLEQAQQQLAQNPNMIREMMNTPAIQNLMN
NPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAARNPELMREMMRNTDRAMS
NIESMPEGFNMLRRMYENVQEPLMNATTMSENAGNNTSSNPFAALLGNQGVTTQGSDTSN
NISAPNAETGTPNANPLPNPWGATAGQTTAPGRTNAGLGGLGGLGGLGGLGMLGADSPLG
ATPDASQLSQILQNPAMSQMMQSVLSNPQYMNQLMSLNPQLRSMLDMNPQLREMMQNPDF
LRQFSSPEMMQQMMSLQQSLFSQNRNTAGQDPTQTGAATGTANNGGLDLLMNMFGSLGAG
GLSGTNQPNVPPEERFATQLQQLQEMGFYDRAENIRALLATNGNVNAAVERLLGSIGQ

MGGEGDSSQPQSGEGEAVAVNIRCSNGTKFSVKTSLDSTVESFKELVAQSSDVPANQQRL
IYKGRILKDDQTLLSYGLQADHTIHMVRGSAPSSAPPPAPAASQTTAPSVTRGVGSDNSS
NLGGASPGESLFPGLGFNPLGGGNAMSGLFGAGLPDLVQTQQQLAQNPNMIRDMMNTPAI
QNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAARNPELMREMMRNT
DRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSGNAGNNTGSNPFAALLGNQGVTTQG
SDASNNSSTPNAGTGTIPNANPLPNPWGATGGQTTAPGRTNVGGDARSPGLGGLGGLGSL
GGLGGLGMLGADSPLGATPDASQLSQLLQNPAISQMMQSVFSNPQYMNQLMSLNPQLRSM
LDSNPQLREMMQNPDFLRQFSSPEMMQQMMTLQQSLSQNRNTASQDAGQTGAATGNNGGL
DLLMNMFGSLGAGGLSGTNQSNVPPEERYATQLQQLQEMGFYDRAENIRALLATNGNVNA
AVERLLGSIGQ

Other information
Ka divergence:-0.189594KaKs divergence:0.327151
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1617Length 2 (bp):1656Length divergence:0.012
MFE 1 (kcal):-518.82MFE 2 (kcal):-564.64MFE divergence0.042