Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17260-AT4G35290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamate receptor 2
Function (paralog2):glutamate receptor 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.17256856771827
Log2 mRNA fold difference:1.1929914311901
Log2 TE fold difference:-1.4478020687579
Sequences
Protein sequence

MSFPTFSFHFSKVSLCFLLKQLLLYGFFFSMNWVLLSFIIVLGGGLLLSEGASSSRPPVI
KVGAIFGLNTMYGETANIAFKAAEEDVNSDPSFLGGSKLRILMNDAKRSGFLSIMGALQF
METDVVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTAPSDLFLM
RAIAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCKISYKAVLPLDVVITSPVE
IIEELIKIRGMESRVIVVNTFPNTGKMIFKEAERLGMMEKGYVWIATTWLSSVLDSNLPL
DTKLVNGVLTLRLHTPDSRKKRDFAARWKNKLSNNKTIGLNVYGLYAYDTVWIIARAVKT
LLEAGGNLSFSNDAKLGSLKGEALNLSALSRFDQGSQLLDYIVHTKMSGLTGPVQFHPDR
SMLQPSYDIINLVDDRVHQIGYWSNYSGLSIVPPESFYSKPPNRSSSNQHLNSVTWPGGT
SVTPRGWIFRNNGRRLRIGVPDRASFKDFVSRVNGSSNKVQGYCIDVFEAAVKLLSYPVP
HEFIFFGDGLTNPNYNELVNKVTTGVDFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVA
PVTRLNENPWAFLRPFTLPMWAVTASFFVIVGAAIWILEHRINDEFRGPPRRQIITILWF
TFSTMFFSHRETTVSTLGRMVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLI
SSTGRIGFQVGSFAENYMTDELNIASSRLVPLASPEEYANALQNGTVAAIVDERPYIDLF
LSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQKIHDRWLSKSNCS
SPHGSQSGDSEQLNVHSFWGMFLVVGIACLVALFIHFFKIIRDFCKDTPEVVVEEAIPSP
KSSRLTKLQTFLAFVDEKEEETKRRLKRKRNNDHSMNANSIISRTASRRPI

MFWVLVLLSFIVLIGDGMISEGAGLRPRYVDVGAIFSLGTLQGEVTNIAMKAAEEDVNSD
PSFLGGSKLRITTYDAKRNGFLTIMGALQFMETDAVAIIGPQTSIMAHVLSHLANELSVP
MLSFTALDPSLSALQFPFFVQTAPSDLFLMRAIAEMISYYGWSEVIALYNDDDNSRNGIT
ALGDELEGRRCKISYKAVLPLDVVITSPREIINELVKIQGMESRVIIVNTFPKTGKKIFE
EAQKLGMMEKGYVWIATTWLTSLLDSVNPLPAKTAESLRGVLTLRIHTPNSKKKKDFVAR
WNKLSNGTVGLNVYGLYAYDTVWIIARAVKRLLDSRANISFSSDPKLTSMKGGGSLNLGA
LSIFDQGSQFLDYIVNTNMTGVTGQIQFLPDRSMIQPSYDIINVVDDGFRQIGYWSNHSG
LSIIPPESLYKKLSNRSSSNQHLNNVTWPGGTSETPRGWVFPNNGRRLRIGVPDRASFKE
FVSRLDGSNKVQGYAIDVFEAAVKLISYPVPHEFVLFGDGLKNPNFNEFVNNVTIGVFDA
VVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKLNDTPWAFLRPFTPPMWAVTAAFFLI
VGSVIWILEHRINDEFRGPPRKQIVTILWFSFSTMFFSHRENTVSTLGRAVLLIWLFVVL
IITSSYTASLTSILTVQQLNSPIRGVDTLISSSGRVGFQVGSYAENYMIDELNIARSRLV
PLGSPKEYAAALQNGTVAAIVDERPYVDLFLSEFCGFAIRGQEFTRSGWGFAFPRDSPLA
IDMSTAILGLSETGQLQKIHDKWLSRSNCSNLNGSVSDEDSEQLKLRSFWGLFLVCGISC
FIALFIYFFKIVRDFFRHGKYDEEATVPSPESSRSKSLQTFLAYFDEKEDESKRRMKRKR
NDDLSLKPSRPI

Other information
Ka divergence:-0.0625739KaKs divergence:-0.00666223
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2856Length 2 (bp):2739Length divergence:-0.021
MFE 1 (kcal):-854.46MFE 2 (kcal):-814.72MFE divergence-0.024