Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17290-AT4G35310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-dependent protein kinase family protein
Function (paralog2):calmodulin-domain protein kinase 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.75789560977459
Log2 mRNA fold difference:0.81011667856698
Log2 TE fold difference:-0.055143631696769
Sequences
Protein sequence

MGNSCRGSFKDKIYEGNHSRPEENSKSTTTTVSSVHSPTTDQDFSKQNTNPALVIPVKEP
IMRRNVDNQSYYVLGHKTPNIRDLYTLSRKLGQGQFGTTYLCTDIATGVDYACKSISKRK
LISKEDVEDVRREIQIMHHLAGHKNIVTIKGAYEDPLYVHIVMELCAGGELFDRIIHRGH
YSERKAAELTKIIVGVVEACHSLGVMHRDLKPENFLLVNKDDDFSLKAIDFGLSVFFKPG
QIFKDVVGSPYYVAPEVLLKHYGPEADVWTAGVILYILLSGVPPFWAETQQGIFDAVLKG
YIDFDTDPWPVISDSAKDLIRKMLCSSPSERLTAHEVLRHPWICENGVAPDRALDPAVLS
RLKQFSAMNKLKKMALKVIAESLSEEEIAGLRAMFEAMDTDNSGAITFDELKAGLRRYGS
TLKDTEIRDLMEAADVDNSGTIDYSEFIAATIHLNKLEREEHLVSAFQYFDKDGSGYITI
DELQQSCIEHGMTDVFLEDIIKEVDQDNDGRIDYEEFVAMMQKGNAGVGRRTMKNSLNIS
MRDV

MGNSCRGSFKDKLDEGDNNKPEDYSKTSTTNLSSNSDHSPNAADIIAQEFSKDNNSNNNS
KDPALVIPLREPIMRRNPDNQAYYVLGHKTPNIRDIYTLSRKLGQGQFGTTYLCTEIASG
VDYACKSISKRKLISKEDVEDVRREIQIMHHLAGHGSIVTIKGAYEDSLYVHIVMELCAG
GELFDRIIQRGHYSERKAAELTKIIVGVVEACHSLGVMHRDLKPENFLLVNKDDDFSLKA
IDFGLSVFFKPGQIFTDVVGSPYYVAPEVLLKRYGPEADVWTAGVILYILLSGVPPFWAE
TQQGIFDAVLKGYIDFESDPWPVISDSAKDLIRRMLSSKPAERLTAHEVLRHPWICENGV
APDRALDPAVLSRLKQFSAMNKLKKMALKVIAESLSEEEIAGLREMFQAMDTDNSGAITF
DELKAGLRKYGSTLKDTEIHDLMDAADVDNSGTIDYSEFIAATIHLNKLEREEHLVAAFQ
YFDKDGSGFITIDELQQACVEHGMADVFLEDIIKEVDQNNDGKIDYGEFVEMMQKGNAGV
GRRTMRNSLNISMRDA

Other information
Ka divergence:0.123146KaKs divergence:0.206924
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1635Length 2 (bp):1671Length divergence:0.011
MFE 1 (kcal):-485.6MFE 2 (kcal):-480.4MFE divergence-0.005