Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17300-AT4G35320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.29744218453482
Log2 mRNA fold difference:1.3239560530963
Log2 TE fold difference:-1.0524621929904
Sequences
Protein sequence

MSSSIMKTLQIRKPTSLPISSTTTDEPGLLRRRLSSLSLNLSRNQPSTVSRSKSVSDMGE
QGGSSVKEWWEWSWSWILLKKLPIFFTDLEVNKNETKSSLGNQQRGSFIHVFFKLRSEIR
RLLRPSSDSLPLSCKHGQR

MSSMMETLQIRKPTSLPVSQRPNAAATADDEPGLIRRRLSSLSLNLSNQPAAIAARFPRS
KSVSAMGEQAGSSVKEWWEWGWSWILSRKPIFIRDLELNKDEAKSIGSQNRGSIMHVFFK
LRSQIRNFMGPSSEDSLPLSCKYKRQR

www.000webhost.com

Other information
Ka divergence:-0.398798KaKs divergence:-0.580433
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):420Length 2 (bp):444Length divergence:0.028
MFE 1 (kcal):-98.63MFE 2 (kcal):-106.5MFE divergence0.038