Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17320-AT4G35360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Uncharacterised conserved protein (UCP030210)
Function (paralog2):Uncharacterised conserved protein (UCP030210)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.27915698220083
Log2 mRNA fold difference:0.72775813236088
Log2 TE fold difference:-0.065680511939186
Sequences
Protein sequence

MIPFPLLPTPIETNYRACTIPYRFPSDNLKKATPTEISWINVFANSIPSFKKRAESDTSV
PDAPARAKIFEQRYAGFLEGWKKDPESNGGPPDGVILGRVREHLLRELGFRDIFKKVKDE
ENAKAISLFPEVVSLSDAIEDDGERLENLVRGIFAGNIFDLGSAQLAEVFSRDGISFLAT
SQNLVPRPWVIDDLNKFQAKWVKKPWKKAVIFVDNSGADIILGILPFARELLRRGIQVVL
AANELPAINDVTYTELTDIVSQLKDGNGQLIGVDTSKLLIANSGNDLAVIDLSRVSHELA
YLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHVEVAQFLGGRLYDCVFKFNEVQ
S

MESDSEMVALPLLPTPIESNYRACTIPYRFPSDNPRKATPTEISWIDLFSNSIPSFKERA
ESDTTVPDAPVRAEKFAKRYAEILEDLKKDPESHGGPPDCILLCRIRELILRELGFRDIF
KKVKDEENAKAISLFPEVVRLSDAINDEGKRIENLVRGIFAGNIFDLGSAQLAEVFSKDG
MSFLASCQNLVSRPWVIDDLDNFQARWLKKPWKKAVIFVDNSGADIILGILPFAREMLRL
GMQVVLAANELPSINDVTYIELAEILSKLNDENGQLMGVDTSNLLIANSGNDLPVIDLAR
VSQEVAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQFLGGRLYDCVI
KYNEVQI

Other information
Ka divergence:-0.294926KaKs divergence:-0.278217
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1086Length 2 (bp):1104Length divergence:0.008
MFE 1 (kcal):-317.6MFE 2 (kcal):-334.72MFE divergence0.026