Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17380-AT4G35410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):associated protein 19
Function (paralog2):Clathrin adaptor complex small chain family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3462408014631
Log2 mRNA fold difference:-1.4057682714085
Log2 TE fold difference:-0.11410015188359
Sequences
Protein sequence

MIHFVLLVSRQGKVRLTKWYSPYTQKERSKVIRELSGVILNRGPKLCNFIEWRGYKVVYK
RYASLYFCMCIDEADNELEVLEIIHHYVEILDRYFGSVCELDLIFNFHKAYYILDELLIA
GELQESSKKTVARIISAQDQLVEVAKEEASSISNIIAQATK

MIHFVLLVSRQGKVRLTKWYSPYAQKERSKVIRELSGVILNRGPKLCNFVEWRGYKVVYK
RYASLYFCMCIDQEDNELEVLEIIHHYVEILDRYFGSVCELDLIFNFHKAYYILDELLIA
GELQESSKKTVARIISAQDQLVEVAKEEASSISNIIAQATNR

www.000webhost.com

Other information
Ka divergence:-0.426882KaKs divergence:0.0702703
GC content 1 (%):43GC content 2 (%):40GC content divergence:-0.036
Length 1 (bp):486Length 2 (bp):489Length divergence:0.003
MFE 1 (kcal):-130.2MFE 2 (kcal):-134.46MFE divergence0.016