Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17390-AT4G35450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ankyrin repeat-containing 2B
Function (paralog2):ankyrin repeat-containing protein 2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.062156009744769
Log2 mRNA fold difference:-0.068132103046507
Log2 TE fold difference:0.0063374521126249
Sequences
Protein sequence

MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPSPTDPGLDFNAFDFSGMAGIL
NDPSIKELAEQIAKDPSFNQLAEQLQRSVPTGSHEGGLPNFDPQQYMQTMQQVMENPEFR
TMAERLGNALVQDPQMSPFLEALGNPAASEQFAERMAQMKEDPELKPILAEIDAGGPSAM
MKYWNDKDVLAKLGEAMGIAVGADQTVAAEPEEAEEGEEEESIVHQTASLGDVEGLKAAL
ASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAIDKNKNTPLHYAAGYGRKE
CVSLLLENGAAVTQQNMDNKNPIDVARLNNQLDVVKLLEKDAFL

MASNSEKNPLLSDEKPKSTEENKSSKPESASGSSTSSAMPGLNFNAFDFSNMASILNDPS
IREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFKTMAE
KLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPILDEIDAGGPSAMMKKN
YLFCFRYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQTASLGDVE
GLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAA
GYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL

www.000webhost.com

Other information
Ka divergence:-0.0481303KaKs divergence:0.381711
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1035Length 2 (bp):1053Length divergence:0.009
MFE 1 (kcal):-320.81MFE 2 (kcal):-326.69MFE divergence0.009