Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17420-AT4G35460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NADPH-dependent thioredoxin reductase A
Function (paralog2):NADPH-dependent thioredoxin reductase B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.844334583513
Log2 mRNA fold difference:-1.7109042778117
Log2 TE fold difference:-0.083079481867663
Sequences
Protein sequence

MSQSRFIIKSLFSTAGGFLLGSALSNPPSLATAFSSSSSSSSAAAAVDMETHKTKVCIVG
SGPAAHTAAIYASRAELKPLLFEGWMANDIAPGGQLTTTTDVENFPGFPEGILGIDIVEK
FRKQSERFGTTIFTETVNKVDFSSKPFKLFTDSRTVLADSVIISTGAVAKRLSFTGSGEG
NGGFWNRGISACAVCDGAAPIFRNKPLVVIGGGDSAMEEANFLTKYGSKVYIIHRRDTFR
ASKIMQQRALSNPKIEVIWNSAVVEAYGDENGRVLGGLKVKNVVTGDVSDLKVSGLFFAI
GHEPATKFLDGQLELDEDGYVVTKPGTTKTSVVGVFAAGDVQDKKYRQAITAAGTGCMAA
LDAEHYLQEIGSQEGKSD

MNCVSRLKCLISKARSFARLGGESTLSQPPSLASAAFSSSAVMNGLETHNTRLCIVGSGP
AAHTAAIYAARAELKPLLFEGWMANDIAPGGQLTTTTDVENFPGFPEGILGVELTDKFRK
QSERFGTTIFTETVTKVDFSSKPFKLFTDSKAILADAVILATGAVAKRLSFVGSGEASGG
FWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASK
IMQQRALSNPKIDVIWNSSVVEAYGDGERDVLGGLKVKNVVTGDVSDLKVSGLFFAIGHE
PATKFLDGGVELDSDGYVVTKPGTTQTSVPGVFAAGDVQDKKYRQAITAAGTGCMAALDA
EHYLQEIGSQQGKSD

Other information
Ka divergence:-0.0860215KaKs divergence:0.266041
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1137Length 2 (bp):1128Length divergence:-0.004
MFE 1 (kcal):-351.95MFE 2 (kcal):-372.61MFE divergence0.029