Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17440-AT4G35470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant intracellular ras group-related LRR 5
Function (paralog2):plant intracellular ras group-related LRR 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.2490847406965
Log2 mRNA fold difference:1.7888381309952
Log2 TE fold difference:1.4138468379403
Sequences
Protein sequence

MDSKEMVVEEIMRIHRSLPLRPEIDDVETATSLIQNVEKEDRNRLEAIDKLVKTSSSEVP
LELFNVFKEMKKSLVRFQSTEQTREATKILDLESVHVVFDELIQRASFCIASPNSTTALP
RSVPVPAPVVSSDEIPFKSKEIISRDDTFVKKAKSSFYSDGLLAPSKPQVLDSTLHQAKN
VAGNDGEKLSLIKLASLIEVSAKKATQELNLQHRLMDQLEWLPDSLGKLSSLVRLDLSEN
CIMVLPATIGGLISLTRLDLHSNRIGQLPESIGDLLNLVNLNLSGNQLSSLPSSFNRLIH
LEELDLSSNSLSILPESIGSLVSLKKLDVETNNIEEIPHSISGCSSMEELRADYNRLKAL
PEAVGKLSTLEILTVRYNNIRQLPTTMSSMANLKELDVSFNELESVPESLCYAKTLVKLN
IGNNFANLRSLPGLIGNLEKLEELDMSNNQIRFLPYSFKTLSNLRVLQTEQNPLEELPRD
ITEKGAQAVVQYMNDLVEARNTKSQRTKPKKSWVNSICFFCKSSTN

MDLMQMDKRLDSTEQVVEEIMRIHRSLPARPGIDEVEAAKGLIDNVEKEDQACLEAIARQ
RKSSEVPGELFMVLQEMKKGYVQFRSKEQIREALKLLDLESVHSLFDDFIQRASNCIASP
SSNGSVSSRPPLPPATTTAARSDSQSSLNFSERAPVRPKDMVSRDDSFVTKSKPSSLYSD
GFAAPPRRPQILDSTLTTGNDGEKLSLIKLASLIEVSAKKATQEINLQNKLTEQLEWLPD
SLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLG
SNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGC
SSLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELE
SVPESLCFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKL
RVFRAQENPLHIPPRDIAEKGPQAVVQYMNDLVETRNAKSLMVKPKKSWVQMCFFSKSNK
RKQSSMEIV

www.000webhost.com

Other information
Ka divergence:-0.335138KaKs divergence:-0.493655
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1581Length 2 (bp):1650Length divergence:0.021
MFE 1 (kcal):-453.12MFE 2 (kcal):-506.74MFE divergence0.056