Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17530-AT4G35500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.41355854447357
Log2 mRNA fold difference:-0.93468963792857
Log2 TE fold difference:0.42130706293492
Sequences
Protein sequence

MSCSSSSGSEEDDEGFDAYRKGGYHAVRIGDQFAGGRYIAQRKLGWGQFSTVWLAYDTRT
SNYVALKIQKSALQFAQAALHEIELLQAAADGDPENTKCVIRLIDDFKHAGPNGQHLCMV
LEFLGDSLLRLIKYNRYKGMELSKVREICKCILTGLDYLHRELGMIHSDLKPENILLCST
IDPAKDPIRSGLTPILEKPEGNQNGTSTMNLIEKKLKRRAKKAAAKISGRRVSIVGLSET
PKKNKRNLDGIDMRCKVVDFGNGCWADNKFAEEIQTRQYRAPEVILQSGYSYSVDMWSFA
CTAFELATGDMLFAPKEGNGYGEDEDHLALMMELLGKMPRKIAIGGARSKDYFDRHGDLK
RIRRLKYWPLDRLLIDKYKLPEAEAREFADFLCPIMDFAPEKRPTAQQCLQHPWLNLRTQ
NNEDDIEGQMSNMQIKGSCS

MSCSSSSGSEGEEEGFDAYRKGGYHAVRIGDPFSGGRYIAQRKLGWGQFSTVWLAYDTLT
SNVLLCMFLCLFAQQFAQAALHEIEFLSAAADGDLDKTKCVVRLIDHFKHSGPNGQHLCM
VLEFLGDSLLRLIRYNQYKGLKLNKVREICRCILTGLDYLHRELGMIHSDLKPENILLCS
TIDPAKDPVRSGLTPLLEKPEGNANGGASTMNLIEKKLKRRAKRAVAKISERRVSMVTGE
EASSKTEKSLDGIDMRCKVVDFGNACWADKQFAEEIQTRQYRAPEVILKSGYSFSVDMWS
FGCTAFELVTGDMLFAPKDGNGYGEDEDHLALMMELLGKMPRKIAIGGAKSKDYFDRHGD
LKRIRRLKYWPLDRLLIDKYKLPEAEAKEFAEFLTPILEFAPEKRPTAQQCLDHPWMNVT
TQNDAENVDDQMNNLHIKG

www.000webhost.com

Other information
Ka divergence:0.225539KaKs divergence:-0.00647017
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1323Length 2 (bp):1320Length divergence:-0.001
MFE 1 (kcal):-374.62MFE 2 (kcal):-389.9MFE divergence0.02