Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17540-AT4G35510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.58254939527208
Log2 mRNA fold difference:-0.55629697031966
Log2 TE fold difference:-0.065183103525514
Sequences
Protein sequence

MATNACLESDSLLPPRKRLLAGFKNQNSRISNESPSPPFASSSSSTTTSNGSSASAVVHT
HHLDHLLNDQTRSPEELAQASKATAALAVKVAKAARATANEKAIIASKAVAAAKNALELF
ASFPAAETVSCKEPRLIRAINNSPRVLTDCSGHRNKKQKTLTSTMNDGNDVAGVVDSDDG
TRVNGKLLLCDNTLKEKTEEESSSLGKRRGRVKLPLSMCAYKDQENGITLEENNLSVSKS
EGYNGGVAQVIERPSWKCQDLKSPECVKQNKVVRS

METNPCDMNQLDSDSHLPPRKRLLAGFKKFNSNGINGSSPSDFASSSSTSNSNGSSSAST
NVQTHLGNLLSSPFNNDQSPEELVEATRSAAALAVKAAKAARAIANEKALISAKAIAAAK
RALELVDSFPKEAMADCKERSPRKNKQKKHVPVELLYSKGQLRDEEDDLARRLHRAIDNT
SYPRVLRTSEENGQRYKKQKKNKSVVEGGSSSIIVTGSMKDIAGVVDSDSSYEGLEIARS
NRDEADSMLMMEKSGEESNSLVKRRGRVKLKKLPLSICNSRNQENGTSSASPLPVAQPQE
DGGAITVIAGSSSWKCQDIKAPECVKQNKAVRS

www.000webhost.com

Other information
Ka divergence:-0.0732344KaKs divergence:-0.308505
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):828Length 2 (bp):1002Length divergence:0.095
MFE 1 (kcal):-254.51MFE 2 (kcal):-317.74MFE divergence0.11