Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17560-AT4G35570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):high mobility group B4
Function (paralog2):high mobility group B5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.582272976298
Log2 mRNA fold difference:-0.46636836472526
Log2 TE fold difference:-0.12301171020602
Sequences
Protein sequence

MKGGESKAEATSTDQRLKTRGRKAGKKTKKDPNQPKRPPSAFFVFLEDFRKEFNLANPNN
KSVATVGKAAGARWKAMTDEDKAPYVAKAESRKTEYIKNVQQYNLKLASGTNREEDDSDK
SKSEVDEAVSEEEAEDDD

MKDNQTEVESRSTDDRLKVRGNKVGKKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNK
SVGNVGRAAGKKWKTMTEEERAPFVAKSQSKKTEYAVTMQQYNMELANGNKTTGDDEKQE
KAADD

Other information
Ka divergence:0.374061KaKs divergence:0.999791
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):417Length 2 (bp):378Length divergence:-0.049
MFE 1 (kcal):-103.24MFE 2 (kcal):-86.77MFE divergence-0.087