Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17620-AT4G35620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cyclin B2;1
Function (paralog2):Cyclin B2;2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.1121225409912
Log2 mRNA fold difference:1.6247168019273
Log2 TE fold difference:0.42321712620389
Sequences
Protein sequence

MVNSCENKIFVKPTSTTILQDETRSRKFGQEMKREKRRVLRVINQNLAGARVYPCVVNKR
GSLLSNKQEEEEGCQKKKFDSLRPSVTRSGVEEETNKKLKPSVPSANDFGDCIFIDEEEA
TLDLPMPMSLEKPYIEADPMEEVEMEDVTVEEPIVDIDVLDSKNSLAAVEYVQDLYAFYR
TMERFSCVPVDYMMQQIDLNEKMRAILIDWLIEVHDKFDLINETLFLTVNLIDRFLSKQN
VMRKKLQLVGLVALLLACKYEEVSVPVVEDLVLISDKAYTRNDVLEMEKTMLSTLQFNIS
LPTQYPFLKRFLKAAQADKKCEVLASFLIELALVEYEMLRFPPSLLAATSVYTAQCTLDG
SRKWNSTCEFHCHYSEDQLMECSRKLVSLHQRAATGNLTGVYRKYSTSKFGYIAKCEAAH
FLVSESHHS

MVNPEENNRNLVVKPITEILQDDDKRSRKFGVEMKRQNRRALGVINHNLVGAKAYPCVVN
KRRGLSQRKQESCDKKKLDSLHPSISRSQEETKKLKPSGNEFGDCIFIDEEEEKNEEVTL
DQPMPMSLEEPYIEFDPMEEEVEMEDMEEEQEEPVLDIDEYDANNSLAAVEYVQDLYDFY
RKTERFSCVPLDYMAQQFDISDKMRAILIDWLIEVHDKFELMNETLFLTVNLIDRFLSKQ
AVARKKLQLVGLVALLLACKYEEVSVPIVEDLVVISDKAYTRTDVLEMEKIMLSTLQFNM
SLPTQYPFLKRFLKAAQSDKKLEILASFLIELALVDYEMVRYPPSLLAATAVYTAQCTIH
GFSEWNSTCEFHCHYSENQLLECCRRMVRLHQKAGTDKLTGVHRKYSSSKFGYIATKYEA
AHFLVSDSH

www.000webhost.com

Other information
Ka divergence:-0.0121887KaKs divergence:0.0776042
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1290Length 2 (bp):1290Length divergence:0
MFE 1 (kcal):-364.2MFE 2 (kcal):-339.8MFE divergence-0.035