Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17630-AT4G35630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pyridoxal phosphate (PLP)-dependent transferases superfamily protein
Function (paralog2):phosphoserine aminotransferase

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.0788167302992
Log2 mRNA fold difference:1.7074092478602
Log2 TE fold difference:0.3698358696718
Sequences
Protein sequence

MAASTNSFLIGNQTQIPSLKPKSISQSFIHFTKPNTINLTTRTKSVSIRCASASTTVGSE
QRVINFAAGPAALPENVLLKAQSDLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLL
EIPSEYSVLFLQGGATTQFAALPLNLCKSDDSVDYIVTGSWGDKAFKEAKKYCNPKVIWS
GKSEKYTKVPTFDGLEQSSDAKYLHICANETIHGVEFKDYPLVENPDGVLIADMSSNFCS
KPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIHDENSSLYNTP
PCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPVEKSVRSLMNV
PFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFMKDFQAR
HA

MAATTNSFLVGSNNTQIPALKPKSSSQSFLHLSKPNTVNFVSKTKPVAVRCVASTTQVQD
GVRSGSVGSQERVFNFAAGPATLPENVLLKAQADLYNWRGSGMSVMEMSHRGKEFLSIIQ
KAESDLRQLLEIPQEYSVLFLQGGATTQFAALPLNLCKSDDTVDFVVTGSWGDKAVKEAK
KYCKTNVIWSGKSEKYTKVPSFEELEQTPDAKYLHICANETIHGVEFKDYPVPKNGFLVA
DMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDITPVMLDYKIHDE
NSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGFFRCPVEK
SVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVA
FMKDFQAKHA

www.000webhost.com

Other information
Ka divergence:0.0852147KaKs divergence:0.176744
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1269Length 2 (bp):1293Length divergence:0.009
MFE 1 (kcal):-379.07MFE 2 (kcal):-389.71MFE divergence0.014