Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17640-AT4G35640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Trimeric LpxA-like enzymes superfamily protein
Function (paralog2):serine acetyltransferase 3;2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.9711345871472
Log2 mRNA fold difference:-1.9747011312646
Log2 TE fold difference:0.047479050492397
Sequences
Protein sequence

MNGDELPFESGFEVYAKGTHKSEFDSNLLDPRSDPIWDAIREEAKLEAEKEPILSSFLYA
GILAHDCLEQALGFVLANRLQNPTLLATQLLDIFYGVMMHDKGIQSSIRHDLQAFKDRDP
ACLSYSSAILHLKGYHALQAYRVAHKLWNEGRKLLALALQSRISEVFGIDIHPAARIGEG
ILLDHGTGVVIGETAVIGNGVSILHGVTLGGTGKETGDRHPKIGEGALLGACVTILGNIS
IGAGAMVAAGSLVLKDVPSHSVVAGNPAKLIRVMEEQDPSLAMKHDATKEFFRHVADGYK
GAQSNGPSLSAGDTEKGHTNSTS

MACINGENRDFSSSSSLSSLPMIVSRNFSARDDGETGDEFPFERIFPVYARGTLNPVADP
VLLDFTNSSYDPIWDSIREEAKLEAEEEPVLSSFLYASILSHDCLEQALSFVLANRLQNP
TLLATQLMDIFCNVMVHDRGIQSSIRLDVQAFKDRDPACLSYSSAILHLKGYLALQAYRV
AHKLWKQGRKLLALALQSRVSEVFGIDIHPAARIGKGILLDHGTGVVIGETAVIGDRVSI
LHGVTLGGTGKETGDRHPNIGDGALLGACVTILGNIKIGAGAMVAAGSLVLKDVPSHSMV
AGNPAKLIGFVDEQDPSMTMEHDATREFFQNVAVAYRETIPNGSSVSGSCRERRH

www.000webhost.com

Other information
Ka divergence:0.0288454KaKs divergence:0.702375
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):972Length 2 (bp):1068Length divergence:0.047
MFE 1 (kcal):-303.14MFE 2 (kcal):-336.52MFE divergence0.052