Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17660-AT4G35655
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RPM1-interacting protein 4 (RIN4) family protein
Function (paralog2):RPM1-interacting protein 4 (RIN4) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.300929209005
Log2 mRNA fold difference:-0.27864439406592
Log2 TE fold difference:-1.5535211515008
Sequences
Protein sequence

MASNEAGRALPKFGEWDVNDPATADGFTVIFSKAGEDKKTGRSSTKTNSQRKQDGDKPAV
KKWLCFTFA

MASNSDARPLPKFGEWDVNDPATAEGFTVIFSKAGEDKKTGRSSSKAPSQRKQDGVKPTK
KWLCFTFS

Other information
Ka divergence:0.259492KaKs divergence:0.571142
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):210Length 2 (bp):207Length divergence:-0.007
MFE 1 (kcal):-56.67MFE 2 (kcal):-49.5MFE divergence-0.068