Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17700-AT4G35780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ACT-like protein tyrosine kinase family protein
Function (paralog2):ACT-like protein tyrosine kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.2614101155633
Log2 mRNA fold difference:1.919393832651
Log2 TE fold difference:0.36622878618878
Sequences
Protein sequence

MTIKDESESCGSRAVVASPSQENPRHYRMKLDVYSEVLQRLQESNYEEATLPDFEDQLWL
HFNRLPARYALDVKVERAEDVLTHQRLLKLAADPATRPVFEVRSVQVSPRISADSDPAVE
EDAQSSHQPSGPGVLAPPTFGSSPNFEAITQGSKIVEDVDSVVNATLSTRPMHEITFSTI
DKPKLLSQLTSLLGELGLNIQEAHAFSTVDGFSLDVFVVDGWSQEETDGLRDALSKEILK
LKDQPGSKQKSISFFEHDKSSNELIPACIEIPTDGTDEWEIDVTQLKIEKKVASGSYGDL
HRGTYCSQEVAIKFLKPDRVNNEMLREFSQEVFIMRKVRHKNVVQFLGACTRSPTLCIVT
EFMARGSIYDFLHKQKCAFKLQTLLKVALDVAKGMSYLHQNNIIHRDLKTANLLMDEHGL
VKVADFGVARVQIESGVMTAETGTYRWMAPEVIEHKPYNHKADVFSYAIVLWELLTGDIP
YAFLTPLQAAVGVVQKGLRPKIPKKTHPKVKGLLERCWHQDPEQRPLFEEIIEMLQQIMK
EVNVVV

MAIKEETEESCGSRAVVASITKESPRQHRMKLEVYGEVLQRIQESNYEEANFPGFDDLLW
LHFNRLPARYALDVNVERAEDVLTHQRLLKLAEDPATRPVFEVRCVQVSPTLNGNSGDVD
PSDPAVNEDAQSSYNSRSLAPPTFGSSPNFEALTQAYKDHAQDDDSAVNAQLPNSRPMHE
ITFSTIDRPKLLSQLTSMLGELGLNIQEAHAFSTADGFSLDVFVVDGWSQEETEGLKDAL
KKEIRKFKDQPCSKQKSITFFEHDKSTNELLPACVEIPTDGTDEWEIDMKQLKIEKKVAC
GSYGELFRGTYCSQEVAIKILKPERVNAEMLREFSQEVYIMRKVRHKNVVQFIGACTRSP
NLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLL
MDEHEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWEL
LTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEM
LNQLIREVGDDERHKDKHGGYFSGLKKGHR

Other information
Ka divergence:-0.284932KaKs divergence:-0.270924
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1641Length 2 (bp):1713Length divergence:0.021
MFE 1 (kcal):-491.31MFE 2 (kcal):-485.4MFE divergence-0.006