Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17730-AT4G35840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NEP-interacting protein 2
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9060037724756
Log2 mRNA fold difference:-1.4217018165858
Log2 TE fold difference:-0.52218709500413
Sequences
Protein sequence

MASSSSSSYRFQSGSYPLSSSPSLGNFVERIKDACHFLVSAVLGTIISAILTFFFALVGT
LLGALTGALIGQETESGFIRGAAIGAISGAVFSIEVFESSLDLWKSDESGFGCFLYLIDV
IVSLLSGRLVRERIGPAMLSAVQSQMGAVDTAFDDHTSLFDTGGSKGLTGDLVEKIPKMT
ITGNNNTDASENTDSCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLLRHDISTARTSR
VCSALLPSSLSFM

MASSRFQSGFCPISSCPSLENFIERIKDACRFTLSAVLGTILSAVLTFFFALVGTLLGAL
TGALIGQETESGFIRGAAVGAISGAVFSIEVFESSLVLWKSNESRFGCLLYLIDVIVSLI
SGRLVRERIGPAMLSAVQSQMGAVDSTFEELSSIFDTGGSKGLTGDLVDKIPKIKITGKN
NLDASGNKDSCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLFRHGSCPMCRRDL

Other information
Ka divergence:-0.360248KaKs divergence:-0.477442
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):762Length 2 (bp):711Length divergence:-0.035
MFE 1 (kcal):-227.5MFE 2 (kcal):-207.52MFE divergence-0.046