Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17770-AT4G35900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic region/leucine zipper motif 27
Function (paralog2):Basic-leucine zipper (bZIP) transcription factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.43151309847689
Log2 mRNA fold difference:-1.0692416919542
Log2 TE fold difference:1.511372825046
Sequences
Protein sequence

MEEVWKEINLGSLHYHRQLNIGHEPMLKNQNPNNSIFQDFLNMPLNQPPPPPPPPSSSTI
VTALYGSLPLPPPATVLSLNSGVGFEFLDTTENLLASNPRSFEESAKFGCLGKKRGQDSD
DTRGDRRYKRMIKNRESAARSRARKQAYTNELELEIAHLQTENARLKIQQEQLKIAEATQ
NQVKKTLQRSSTAPF

MLSSAKHQRNHRLSATNKNQTLTKVSSISSSSPSSSSSSSSTSSSSPLPSQDSQAQKRSL
VTMEEVWNDINLASIHHLNRHSPHPQHNHEPRFRGQNHHNQNPNSIFQDFLKGSLNQEPA
PTSQTTGSAPNGDSTTVTVLYSSPFPPPATVLSLNSGAGFEFLDNQDPLVTSNSNLHTHH
HLSNAHAFNTSFEALVPSSSFGKKRGQDSNEGSGNRRHKRMIKNRESAARSRARKQAYTN
ELELEVAHLQAENARLKRQQDQLKMAAAIQQPKKNTLQRSSTAPF

www.000webhost.com

Other information
Ka divergence:-0.318675KaKs divergence:-0.218893
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):588Length 2 (bp):858Length divergence:0.187
MFE 1 (kcal):-137.5MFE 2 (kcal):-189.06MFE divergence0.158