Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17780-AT4G35920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PLAC8 family protein
Function (paralog2):PLAC8 family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.6033808358892
Log2 mRNA fold difference:1.5626770580137
Log2 TE fold difference:1.0376529024943
Sequences
Protein sequence

MANSWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQI
KNSEMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGWNIVNQFEKAQNEIDL
FLKIVPLINMADNARIRERLEAIERDQREYTLDEEDRKVQDVILKQESTREAATSVLKKT
LSRSYPNMGFCEALKTEEEKLQLELQRSRARYDADQCEVIQRLIDVTQTAATVEPNLEKV
LTKKEELTSSKKRDDLYDTDSSSIRADSRSTSYVSSGHELLSGRSLQHRGNWHADLLDCC
SEPCLCLKTLFFPCGTLAKISTVATSRQISSTEVCKNLIVYSLILSCCCYTCCIRKKLRK
TLNITGGCIDDFLSHLMCCCCALVQELREVEIHRASYGTEKSNKEMSPPTPQFMEE

MSHSWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQL
KISEMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGWNIVYQFRKHQDEIDR
FLKIIPLITLVDNARIRERFEYIDRDQREYTLDEEDRHVQDVILKQESTREAASVLKKTL
SCSYPNLRFCEALKTENEKLQIELQRSQEHYDVAQCEVIQRLIGVTQAAAAVEPDSEKEL
TKKASKKSERSSSMKTEYSYDEDSPKKSSTRAASRSTSNVSSGHDLLSRRASQAQHHEEW
HTDLLACCSEPSLCFKTFFFPCGTLAKIATAASNRHISSAEACNELMAYSLILSCCCYTC
CVRRKLRKTLNITGGFIDDFLSHVMCCCCALVQELREVEIRGAYGTEKTKISPPSSQFME
H

www.000webhost.com

Other information
Ka divergence:-0.509384KaKs divergence:-0.543514
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1251Length 2 (bp):1266Length divergence:0.006
MFE 1 (kcal):-349.7MFE 2 (kcal):-391.27MFE divergence0.056