Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17800-AT4G35950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Arabidopsis RAC-like 1
Function (paralog2):RAC-like 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.38448434233832
Log2 mRNA fold difference:0.51627211264554
Log2 TE fold difference:-0.04600163166071
Sequences
Protein sequence

MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD
TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL
DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVLQP
PKQKKKKSKAQKACSIL

MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD
TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL
DLRDDKQFFIDHPGAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQP
PKQKKKKNKAQKACSIL

www.000webhost.com

Other information
Ka divergence:0.336849KaKs divergence:0.257951
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):594Length 2 (bp):594Length divergence:0
MFE 1 (kcal):-174.4MFE 2 (kcal):-172.14MFE divergence-0.007