Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17870-AT4G36020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cold shock domain protein 3
Function (paralog2):cold shock domain protein 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.67413177397368
Log2 mRNA fold difference:-0.21537219353708
Log2 TE fold difference:-0.4924703872291
Sequences
Protein sequence

MAMEDQSAARSIGKVSWFSDGKGYGFITPDDGGEELFVHQSSIVSDGFRSLTLGESVEYE
IALGSDGKTKAIEVTAPGGGSLNKKENSSRGSGGNCFNCGEVGHMAKDCDGGSGGKSFGG
GGGRRSGGEGECYMCGDVGHFARDCRQSGGGNSGGGGGGGRPCYSCGEVGHLAKDCRGGS
GGNRYGGGGGRGSGGDGCYMCGGVGHFARDCRQNGGGNVGGGGSTCYTCGGVGHIAKVCT
SKIPSGGGGGGRACYECGGTGHLARDCDRRGSGSSGGGGGSNKCFICGKEGHFARECTSV
A

MASEDQSAARSTGKVNWFNASKGYGFITPDDGSVELFVHQSSIVSEGYRSLTVGDAVEFA
ITQGSDGKTKAVNVTAPGGGSLKKENNSRGNGARRGGGGSGCYNCGELGHISKDCGIGGG
GGGGERRSRGGEGCYNCGDTGHFARDCTSAGNGDQRGATKGGNDGCYTCGDVGHVARDCT
QKSVGNGDQRGAVKGGNDGCYTCGDVGHFARDCTQKVAAGNVRSGGGGSGTCYSCGGVGH
IARDCATKRQPSRGCYQCGGSGHLARDCDQRGSGGGGNDNACYKCGKEGHFARECSSVA

Other information
Ka divergence:-0.210023KaKs divergence:0.436274
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):906Length 2 (bp):900Length divergence:-0.003
MFE 1 (kcal):-296.2MFE 2 (kcal):-322.1MFE divergence0.042