Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17880-AT4G36040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chaperone DnaJ-domain superfamily protein
Function (paralog2):Chaperone DnaJ-domain superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.2382225491115
Log2 mRNA fold difference:2.6808838459431
Log2 TE fold difference:1.5217617690441
Sequences
Protein sequence

MLSSSPTFFATPFLSSSSSSSPSFSSTSPPSRISRISPSLSTTTASYTCAEDLPRLRQIP
QRFSATASLYEILEIPVGSTSQEIKSAYRRLARICHPDVARNSRDNSSADDFMKIHAAYC
TLSDPEKRAVYDRRTLLRSRPLTAGYGSYGGRNWETDQCW

MLSSSPTSFTHPFLSSSPPLSPISPPSRTARISPPLVSASCSYTYTEDSPRLHQIPRRLT
TVPASLYDVLEVPLGATSQDIKSAYRRLARICHPDVAGTDRTSSSSADEFMKIHAAYCTL
SDPEKRSVYDRRMLRRSRPLTVGTSGLGSYVGRNWETDQCW

www.000webhost.com

Other information
Ka divergence:-0.0253305KaKs divergence:-0.760759
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):483Length 2 (bp):486Length divergence:0.003
MFE 1 (kcal):-143.02MFE 2 (kcal):-160.06MFE divergence0.056