Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17970-AT4G36090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):oxidoreductase, 2OG-Fe(II) oxygenase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.4626386393624
Log2 mRNA fold difference:0.86855452400278
Log2 TE fold difference:1.6279175258753
Sequences
Protein sequence

MENDPFLRQYQPSELKIASEFLTNWLPFLSKDLCKDCNHLLSNRIRSLDPAHCSNNTDKV
DGECKTGSCSVVENMGSERASNNVDDNYDEKSENGEDCDNHSLGSWKGSEIVFGSFPEDF
SSVLQSRPAVVETASPRMRWADMAQEDEFDEEEEEEEEERDSSRKGFDASSMKTPEKPKL
SRDQRENLRLINVKRKKDFICLERVKGKIVNVLDGLELHTGVFSAVEQKRIVDQVYQLQE
KGRRGELKKRTFTAPHKWMRGKGRETIQFGCCYNYAPDRAGNPPGILQREEVDPLPHLFK
VIIRKLIKWHVLPPTCVPDSCIVNIYDEGDCIPPHIDNHDFLRPFCTISFLSECDILFGS
NLKVEGPGDFSGSYSIPLPVGSVLVLNGNGADVAKHCVPAVPTKRISITFRKMDESKRPV
WFTPEPDLQGIEPLPLDLNRSGSTSRFSRLNNHNGTNQRGHGRRGGGNGYDSRGYYNPER
SSEHNDSGDWPSSQRRGMPRPSRRNYG

MEPNYEEDVFLAKYQSSELKIASEFLTNWLPFLSRDLCNDCAHVLSDRIRSLDPEHCSNG
EVKAGSGSMVDNMESEEVDNMESEEVDNKMDNIYDGKLCVSHSLDSLKAGAFVFGSLSDS
VSHAMPSSQSTVSEAASAQMSWADMGEEDGLEEEDQKENELGSHGVDVSPSVGDSMKTPE
KRKLSREERERYRFMNVKKMKVFSCYEKVRGRSVNILEGLELHTGVFSAVEQKKIVDFVY
ELQEKGRRGELRERTFTAPHKWMRGKGRVTIQFGCCYNYAPDKAGNPPGILQRGDVDPMP
SIFKVIIKRLVGWHVLPPTCVPDSCIVNIYEEDDCIPPHIDNHDFLRPFCTVSFLSECNI
LFGSNLKVLGPGEFSGSYSIPLPVGSVLVLKGNGADVAKHCVPAVPTKRISITFRKMDES
KRPVGFTPEPDLEEIKPLPYEHTTPSTPADAVISSSRSSIDQNGSNHNNRTAHGGGSKYR
RSRDYHSESRERSSSGQRRETSRHTPNRSYRPKVTSSDNV

www.000webhost.com

Other information
Ka divergence:0.115943KaKs divergence:-0.24018
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1524Length 2 (bp):1563Length divergence:0.013
MFE 1 (kcal):-469.66MFE 2 (kcal):-447.46MFE divergence-0.024