Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G17990-AT4G36105
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-4.2587461960566
Log2 mRNA fold difference:-4.6715455177829
Log2 TE fold difference:0.41553193500003
Sequences
Protein sequence

MAGKEETDVSAQGSLTREATEIWRSELESRRFQVDSLEAELVDVKAYLEFGSEEDARKEL
GVLSGRVRSTATMLRYLRSKARVLAIPDDLANVSCGVEQIEELKGLNLVEKDGGSSSSDG
ARNTNPETRRYSGSLGVEDGAYTNEMLQSIEMVTDVLDSLVRRVTVAESESAVQKERALL
GEEEISRKTIQIENLSVKLEEMERFAYGTNSVLNEMRERIEELVEETMRQREKAVENEEE
LCRVKREFESLKSYVSTFTNVRETLLSSERQFKTIEELFERLVTKTTQLEGEKAQKEVEV
QKLMEENVKLTALLDKKEAQLLALNEQCKVMALSASNI

MAGTSMAEPEGVKMSHDCSEEDARKELKVLLDRVKSAATSLSYLRSKARILAVPGLSLGA
QQLQLKDDTTLAGTNKNKDSLVIEDGVYTLNTLQSIEMVITDALESLLRRVTAAESETCS
HKEKVIICEEEITRKTVQIQNLSLRLEQTERIVMTECESLKNALTASNNVLDTLLSSSRR
HFQTIEARYKLQSMLVAKSTQLEGEKAQKEVQVQKLMEENMKLTTLLDKKEAQLLALNEQ
CKVMALNASNI

Other information
Ka divergence:0.481872KaKs divergence:0.514891
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1017Length 2 (bp):756Length divergence:-0.147
MFE 1 (kcal):-290.18MFE 2 (kcal):-210.26MFE divergence-0.16