Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18060-AT4G36160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vascular related NAC-domain protein 1
Function (paralog2):NAC domain containing protein 76

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.52676412552609
Log2 mRNA fold difference:0.73254148353012
Log2 TE fold difference:-1.33408639493
Sequences
Protein sequence

MEPMESCSVPPGFRFHPTDEELVGYYLRKKIASQKIDLDVIRDIDLYRIEPWDLQEQCRI
GYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYDKTKLIGMRKTLVFYKG
RAPNGKKSDWIMHEYRLESDENAPPQEEGWVVCRAFKKRATGQAKNTETWSSSYFYDEVA
PNGVNSVMDPIDYISKQQHNIFGKGLMCKQELEGMVDGINYIQSNQFIQLPQLQSPSLPL
MKRPSSSMSITSMDNNYNYKLPLADEESFESFIRGEDRRKKKKQVMMTGNWRELDKFVAS
QLMSQEDNGTSSFAGHHIVNEDKNNNDVEMDSSMFLSEREEENRFVSEFLSTNSDYDIGI
CVFDN

MESVDQSCSVPPGFRFHPTDEELVGYYLRKKVASQKIDLDVIRDIDLYRIEPWDLQESCR
IGYEERNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYDKSKLIGMRKTLVFYK
GRAPNGQKTDWIMHEYRLESDENAPPQEEGWVVCRAFKKKPMTGQAKNTETWSSSYFYDE
LPSGVRSVTEPLNYVSKQKQNVFAQDLMFKQELEGSDIGLNFIHCDQFIQLPQLESPSLP
LTKRPVSLTSITSLEKNKNIYKRHLIEEDVSFNALISSGNKDKKKKKTSVMTTDWRALDK
FVASQLMSQEDGVSGFGGHHEEDNNKIGHYNNEESNNKGSVETASSTLLSDREEENRFIS
GLLCSNLDYDLYRDLHV

www.000webhost.com

Other information
Ka divergence:0.0680021KaKs divergence:0.369505
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):1098Length 2 (bp):1134Length divergence:0.016
MFE 1 (kcal):-280.39MFE 2 (kcal):-291.7MFE divergence0.02