Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18100-AT4G36210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF726)
Function (paralog2):Protein of unknown function (DUF726)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.8569888389129
Log2 mRNA fold difference:4.593023204826
Log2 TE fold difference:0.22305138216647
Sequences
Protein sequence

MVEATSNLTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSDSDPISDEADL
WVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSSEM
VEKETALAKAADAMDQNIRSSSLSVESKMEKHVEFENECRDKYSVPEAQSGAEVKETESH
GEGEIRDGGHNLGIVEHEKPVGEVALLSHERKINVLYELLSACLADKHEENEICTRRRKG
YDARHHVALRLLATWFDFQWIKMEAVETMSACSAMALQKSSGNKEEESLSPNSEWAKWKR
GGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIVPVIGASGFAAAAEAAGTVA
GSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEILVAGFVLKEED
FVKPWEGLTSNLERYTVQWESENIIAVSTAIQDWLTSRVAMELMRQGAMRTVLNSLLAAM
VWPATILVAADFIDSRWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKC
LQTLAETEKNAEIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRAS
LLSQGLAGIQPVCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVFRNTL

MVEATSNLTPTQRYAAGALFAIALNQAQINQTQPLGTPAAEDDDGGDEERRSNCSSGDSV
SDDPSLWVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEANDAS
AEMVEQEMALAKAADAMVHSIQCSVSIDAKKEKHQEYENECREKYAVPEVKSKDVDLDKE
KDKKEAAESAAREGLEAGVVIIDGSHKPEVLENEKSVEEVTLLSHQRKINVLYELLSACL
SDKHHEDKKCKRCRKGYDARHRVALRLLATWFNIEWIKVEAIETMVACSAMAIQKSAEMK
GEDNLTPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVI
GAGGFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGR
LAVEVLVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELM
KQGAMHTVLASLLMALAWPATILVAADFIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRP
ITLVGFSLGARVIFKCLQALAETEQNAELVERVVLLGAPISINSENWRDVRKMVAGRFIN
VYATNDWTLGIAFRASLISQGLAGIQPICIPGIENVDVTDMVEGHSSYLWKTQQILERLE
IDTYYPVFRDTL

Other information
Ka divergence:-0.151797KaKs divergence:-0.121149
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1971Length 2 (bp):2019Length divergence:0.012
MFE 1 (kcal):-667.8MFE 2 (kcal):-674.34MFE divergence0.005