Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18170-AT4G36450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MAP kinase 7
Function (paralog2):mitogen-activated protein kinase 14

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.8267272592171
Log2 mRNA fold difference:-3.4179262238733
Log2 TE fold difference:-0.02112974301859
Sequences
Protein sequence

MAMLVEPPNGIKQQGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSINRETNERVAI
KKIHNVFENRVDALRTLRELKLLRHVRHENVIALKDVMLPANRSSFKDVYLVYELMDTDL
HQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTSQGNEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECL
NQLKLIINVVGSQQESDIRFIDNPKARRFIKSLPYSRGTHLSNLYPQANPLAIDLLQRML
VFDPTKRISVTDALLHPYMAGLFDPGSNPPAHVPISLDIDENMEEPVIREMMWNEMLYYH
PEAEISNA

MAMLVDPPNGIRQEGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGVVCSSINSETNERVAI
KKIHNVFENRIDALRTLRELKLLRHVRHENVISLKDVMLPTHRYSFRDVYLVYELMDSDL
NQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTYEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPIFPGTECLNQL
KLIINVVGSQQDWDLQFIDNQKARRFIKSLPFSKGTHFSHIYPHANPLAIDLLQRMLVFD
PTKRISVSDALLHPYMEGLLEPECNPSENVPVSSLEIDENMEGDMIREMMWEEMLHYLPR
A

Other information
Ka divergence:0.415633KaKs divergence:0.554997
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1107Length 2 (bp):1086Length divergence:-0.01
MFE 1 (kcal):-320.37MFE 2 (kcal):-306.96MFE divergence-0.021