Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18190-AT2G18193
Species:Arabidopsis
Duplication type:TD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.0292487854078
Log2 mRNA fold difference:2.9417344372514
Log2 TE fold difference:0.02044350393223
Sequences
Protein sequence

MFPSISNISLSPSSLFTAYASLTGFLMLFRSLFNDEVPERLRSYITDLLNRFFTPKSKNL
TMVIDEIIGFKRNQVFDAAEVYLRNKIGPETARLRVGKLPKQKHFTIYIEKGEEILDTFE
NSELRWTYVESENEASQKEKRYYELTFEKKLRDKVMNSYLSHVVAESEETKRDLRAVKLY
SRDVRASKDDDGMAGAGWGCINLEHPSTFETLAMDPGAKKKIIDDMERFLKRREFYKRVG
KAWKRGYLLYGPPGTGKSSLIAAMANYLKFDVFDLELSSIYENAQLKSILLSTTNRSILV
IEDIDCSSAEVVDREADEYQEYEEGYYGRVTLSGLLNFVDGLWSSFGDERIIVFTTNHKE
RLDPALLRPGRMDMHINMSYCTGLGFRTLVSNYLGLGGLNHPLCEEIEALIDSTEVTPAE
LAEELMQEDDTDVVLRGVVSFVENRKVEISKTKELEGSTCRKLDGDDKHNVSSTNDLKKT
KKKKKGGKGKAKGN

MFPSSDFSFSPSSLFSAYASLTGFLMLFRSMLHDFVPEKLRSYFSSLLDRFFTPKSKYLT
VIIDENFGLNRNQVFDAAEMYLRSKIGPETERLRVGKIPKQKHFTISIERGEEILDTFEE
SEVKWSYVQSENEKGDKVKRYYELTFEKKLRDKVLNSYLTHVVAESEEIKRNLRVVKLYS
RDVYASDDDDGMAGGNWGCINLEHPSTFDTLAMDPNAKKKIIDDLERFLKRKEFYKRVGK
AWKRGYLLYGPPGTGKSSLIAAMANYLKFDVFDLELSSIYDNGELKRVLLSTTNRSILVI
EDIDCNAEVRDREAENQEDEQIKGKVTLSGILNFIDGLWSSFGDERIIVFTTNHKERLDP
ALLRPGRMDVHINMSYCTGLGFRTLVSNYLGLDGLNHPLCEEIEALVDSTEVTPAELAEE
LMQDDDTDVVLRGVISFVEKRKVERSKTKKEVSICKATDDDEKQNGSLGCVKKKKKGGKQ
KGKGKGKGKAKTYLI

Other information
Ka divergence:-0.234299KaKs divergence:-0.362844
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1485Length 2 (bp):1488Length divergence:0.001
MFE 1 (kcal):-431.38MFE 2 (kcal):-425.6MFE divergence-0.007